DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and CG5162

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster


Alignment Length:249 Identity:82/249 - (32%)
Similarity:121/249 - (48%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GWTQSYTASMNKDIRS-AWLSRGDYNVIVVDWARARSVDYATSVLAVAATGKKVA----KMINFL 167
            |||.:...|...::.| |:..|||.|.:.||.||.....|..|.......|:.:|    |:::.:
  Fly   139 GWTTTVNGSDTIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLDLV 203

  Fly   168 KDNHGLNLNDLYVIGHSLGAHVAGYAGKN----TDGQVHTIIGLDPALPLFSYNKPNKRLNSDDA 228
            .      :.::::||||||||:.|.||::    |:..:..|.|||||.|.|:..:....|...||
  Fly   204 P------VENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDA 262

  Fly   229 WYVESIQTNGGTLGFLKPIGKGAFYPNG-GKTQPGCGLDLTGACSHGRSTTYYAEAV---SEDNF 289
            .:|:.|.:|.|.||...|:|...|||.| .....||   .:..|:|.||..|:||.|   :|.||
  Fly   263 HFVDVIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGC---FSVTCAHARSWEYFAETVFPGNERNF 324

  Fly   290 GTMKCGDYEEAVSKECGSTYSSVRMGADTNAYMV----EGDYYVPVNSKAPFGM 339
            ...:|....:.....|..  ..|.||     |.|    :|:|::.|::.|||||
  Fly   325 MATRCNSISKLRDFRCPG--DEVPMG-----YAVPQNIKGNYFLEVSASAPFGM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 77/241 (32%)
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 78/245 (32%)
Pancreat_lipase_like 99..365 CDD:238363 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446063
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.