DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and Yp1

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster


Alignment Length:422 Identity:98/422 - (23%)
Similarity:170/422 - (40%) Gaps:98/422 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKTFLILAFFALAASAIP-----------IKESERVHGENGWYVPQ-EDGTSEWVD-------MD 46
            |:...:||..|:||.|.|           :|.|:.:.|.....:|. :|.|.|.::       .:
  Fly     4 MRVLSLLACLAVAALAKPNGRMDNSVNQALKPSQWLSGSQLEAIPALDDFTIERLENMNLERGAE 68

  Fly    47 VAEQWMEAQELLESRGLTTVPVKFYLYTSSNPTKGK---------------------KITASTKS 90
            :.:|.....::..:.....||....:|. ..|...|                     ::|.....
  Fly    69 LLQQVYHLSQIHHNVEPNYVPSGIQVYV-PKPNGDKTVAPLNEMIQRLKQKQNFGEDEVTIIVTG 132

  Fly    91 IDASSFNSAHPTRFVIHGWTQSY----------------------------TAS---MNKDIRSA 124
            :..:|......||.::..:.|.|                            |:|   .::::::|
  Fly   133 LPQTSETVKKATRKLVQAYMQRYNLQQQRQHGKNGNQDYQDQSNEQRKNQRTSSEEDYSEEVKNA 197

  Fly   125 WLSRGDYNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLGAHV 189
            ....||  :||:|.....:.....::|.:..||.|:.|.|..:.:...:..:.:::||.::||||
  Fly   198 KTQSGD--IIVIDLGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQNVGAHV 260

  Fly   190 AGYAGKN----TDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKG 250
            ||.|.:.    |..::..:.||||:..:.........|...||.:|::|.|:  ..|...||..|
  Fly   261 AGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTS--VYGMGTPIRSG 323

  Fly   251 --AFYPNGGKTQPGCGLDLTGAC----SHGRSTTYYAEAV---SEDNFGTMKCGDYEEAVSKECG 306
              .|||||    |..|  :.||.    :..|:|.|:||:|   :|.:|..:.....::  .|:..
  Fly   324 DVDFYPNG----PAAG--VPGASNVVEAAMRATRYFAESVRPGNERSFPAVPANSLQQ--YKQND 380

  Fly   307 STYSSVRMGADTNAYMVEGDYYVPVNSKAPFG 338
            .......||.|| |:.:||||.:.||.|:|||
  Fly   381 GFGKRAYMGIDT-AHDLEGDYILQVNPKSPFG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 75/329 (23%)
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 66/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445888
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.