DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and CG1986

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster


Alignment Length:328 Identity:97/328 - (29%)
Similarity:153/328 - (46%) Gaps:26/328 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VPQEDGTSEWVDMDVAEQWMEAQELLES--RGLTTVPVKFYLYTSSNPTKGKKITASTKSIDASS 95
            ||:.:....|..|..|.::::...|..|  |......:.|...|.|....|.::..:.:..|...
  Fly    21 VPRIEAFHRWSPMMKAFRYLQETMLRNSLERAHLNHGIVFECRTISAKDFGNEVHFNLQLGDLRG 85

  Fly    96 FNSAHPTR---FVIHGWTQSYTASMNKDIRSAW-LSRGDYNVIVVDWARARSVDYATSVLAVAAT 156
            |....|.:   ..:|||....:....:::...| |...:|||.||||......||.::.:::...
  Fly    86 FRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTLFDSNYNVCVVDWGNLSQNDYKSASMSIFDV 150

  Fly   157 GKKVAKMINFLKD---NHGLNLNDLYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYN- 217
            |..||.:|..|::   || .:.:::.:.|:|||||.|||||...:|||..|||||||.||||.. 
  Fly   151 GLTVAGIIMALEELRPNH-FHRSNVTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPA 214

  Fly   218 --KPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPNGGKT-QPGCGL-----DLTG----A 270
              .|..||:..||.:|:.:.|:||:||.....|...||||||:. |..|.:     |:..    :
  Fly   215 EVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPVS 279

  Fly   271 CSHGRSTTYYAEAVS-EDNFGTMKCGDYEEAVSKECGSTYSSVRMGADTNAYMVEGDYYVPVNSK 334
            |||..:..::.:::. |..|...:||.|.|..:..|... ...|.|..:.. ..:|.:|.....:
  Fly   280 CSHSAAAIFFRQSMDPEYPFVGYECGSYREFAAGYCDGN-RKARFGIHSQR-RAQGSFYFRTAPQ 342

  Fly   335 APF 337
            .|:
  Fly   343 QPY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 88/285 (31%)
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 85/276 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.