DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and CG5966

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster


Alignment Length:317 Identity:91/317 - (28%)
Similarity:144/317 - (45%) Gaps:52/317 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SRGLTTVPVK-------FYLYTSSNPTKGKKITAS-TKSIDASSFNSAHPTRFVIHGWTQSYTAS 116
            :|.:...|.|       |.|:|.....:.|.:..: .:|:.....|.......::||:.:|....
  Fly    63 TRSINVHPQKPSEIEPHFTLHTRRALDQPKYLDLNDPESVQGMGMNPKGKIFLLVHGYLESGEIP 127

  Fly   117 MNKDIRSAWLS---RGDYNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGL-NLND 177
            ...|:..|.|:   .|..:|:::||....|..|..:|..:...|...|.:::.|.:...| ||::
  Fly   128 WMWDMAKALLAHEPEGRASVVLIDWGGGASPPYVQAVANIRLVGAITAHVVHMLYEELRLPNLDN 192

  Fly   178 LYVIGHSLGAHVAGYAGKNTDGQVH-------TIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQ 235
            :::||||||||::||||.:..   |       .|.|||||.|||:...|..||:..||.:|:.:.
  Fly   193 VHIIGHSLGAHLSGYAGYHLQ---HDFGLKPARITGLDPAAPLFTDTDPIVRLDKTDAHFVDIVH 254

  Fly   236 TNG-----GTLGFLKPIGKGAFYPNGGKTQPGCG-----------LDLTG----ACSHGRSTTYY 280
            |:.     |.||....:|...|:||||...|||.           |.||.    .|:|.||..|:
  Fly   255 TDANPLMKGGLGINMRLGHVDFFPNGGFDNPGCNKKFQDVVKKKTLFLTMQEFLGCNHIRSQQYF 319

  Fly   281 AEAV-SEDNFGTMKCGDYEEAVSKECGST----YSSVRMGADTNAYMVEGDYYVPVN 332
            .|:: |:..|..:.|..:|.....:|.|.    ::.:|||     |..:.||...|:
  Fly   320 TESIGSQCPFLGITCDSFESFKDTKCTSCEEPGHTCLRMG-----YHSQEDYQEQVD 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 89/309 (29%)
CG5966NP_572286.1 Lipase 46..394 CDD:278576 91/317 (29%)
Pancreat_lipase_like 76..390 CDD:238363 88/304 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.