DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and lpl

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_571202.1 Gene:lpl / 30354 ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio


Alignment Length:327 Identity:98/327 - (29%)
Similarity:143/327 - (43%) Gaps:49/327 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DGTSEWVDM-DV---AEQWMEAQELLESRGLTTVPVKFYLYTSSNPTKG--KKITASTKSIDASS 95
            |.|:|.:.: |:   |.:||        ...|.:..||...|...|...  ..:....:||...:
Zfish    31 DPTAESITLSDIIGNATEWM--------MDFTDIESKFSFRTLEEPEDDLCYIVPGQPQSIKDCN 87

  Fly    96 FNSAHPTRFVIHGWTQS--YTASMNKDIRSAWLSRGDYNVIVVDWARARSVDYATSVLAVAATGK 158
            ||:...|..||||||.:  :.:.:.|.:.:.:......|||||||.......|.||.......||
Zfish    88 FNTETKTFIVIHGWTVTGMFESWVPKLVTALYEREPSANVIVVDWLSRAQQHYPTSASYTKLVGK 152

  Fly   159 KVAKMINFLKDNHGLNLNDLYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRL 223
            .|||.:|:|:.........|:::|:||||||||.||..|..:|:.|.|:|||.|.|.|......|
Zfish   153 DVAKFVNWLQAEIDYPWEKLHLLGYSLGAHVAGIAGLLTKHKVNRITGMDPAGPTFEYADSLSTL 217

  Fly   224 NSDDAWYVESIQTN-----GGTLGFLKPIGKGAFYPNGGKTQPGCGLD-------LTG------- 269
            :.|||.:|:.:.||     ..::|..:|:|....|||||..||||.|.       .||       
Zfish   218 SPDDANFVDVLHTNTRGSPDRSIGIQRPVGHIDIYPNGGTFQPGCDLQNTMLMVATTGLRNMDQI 282

  Fly   270 -ACSHGRSTTYYAEAV-------------SEDNFGTMKCGDYEEAVSKECGSTYSSVRMGADTNA 320
             .|||.||...:.:::             |.|:|....|....:....:.|...:.:|....:..
Zfish   283 VKCSHERSIHLFIDSLVNQDHESMAFRCSSRDSFNKGMCLSCRKNRCNKVGYAVNKIRTRRSSKM 347

  Fly   321 YM 322
            ||
Zfish   348 YM 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 90/292 (31%)
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 91/298 (31%)
Pancreat_lipase_like 56..353 CDD:238363 90/294 (31%)
PLAT 360..484 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.