DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and Lipg

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001012759.1 Gene:Lipg / 291437 RGDID:1310740 Length:493 Species:Rattus norvegicus


Alignment Length:308 Identity:100/308 - (32%)
Similarity:158/308 - (51%) Gaps:39/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LTTVP-VKFYLYTSSNPT-KGKKIT-ASTKSIDASSFNSAHPTRFVIHGWTQS--YTASMNKDIR 122
            :||.| |.|.:.||.:|. :|..:: ..:|.::...||....|.|:|||||.|  :.:.::|.:.
  Rat    45 ITTKPSVTFNIRTSKDPEHEGCNLSLGDSKLLENCGFNMTAKTFFIIHGWTMSGMFESWLHKLVS 109

  Fly   123 SAWLSRGDYNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLGA 187
            :......:.||:||||.......|..:|......|::||.|:|:|::....:|.|:::||:||||
  Rat   110 ALQTREKEANVVVVDWLPLAHQLYIDAVSNTRVVGRRVAGMLNWLQEKGEFSLGDVHLIGYSLGA 174

  Fly   188 HVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTN----GGTLGFLKPIG 248
            |||||||....|.|..|.|||||.|:|.....|:||:.|||.:|:.:.|.    |.::|...|:|
  Rat   175 HVAGYAGNFVKGTVGRITGLDPAGPMFEGVDINRRLSPDDADFVDVLHTYTLSFGLSIGIRMPVG 239

  Fly   249 KGAFYPNGGKTQPGCGL-DLTGA-----------CSHGRSTTYYAEA-VSED--NFGTMKCGD-- 296
            ....|||||..|||||. |:.|:           |.|.|:...:.:: |::|  :| ..:|.|  
  Rat   240 HIDIYPNGGDFQPGCGFNDVMGSFAYGTISEMVKCEHERAVHLFVDSLVNQDKPSF-AFQCTDPN 303

  Fly   297 -YEEAVSKECGST------YSSVRMGADTNAYMVEGDYYVPVNSKAPF 337
             ::..:...|...      |::.:|....|:.|     |:...:..||
  Rat   304 RFKRGICLSCRKNRCNNIGYNAKKMRKKRNSKM-----YLKTRAGMPF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 95/296 (32%)
LipgNP_001012759.1 Pancreat_lipase_like 51..342 CDD:238363 95/296 (32%)
lipo_lipase 53..488 CDD:132274 96/300 (32%)
Heparin-binding. /evidence=ECO:0000250 327..339 4/16 (25%)
PLAT_LPL 349..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.