DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and Lipc

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_006243421.1 Gene:Lipc / 24538 RGDID:3009 Length:510 Species:Rattus norvegicus


Alignment Length:272 Identity:85/272 - (31%)
Similarity:139/272 - (51%) Gaps:42/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ESRGLTTVPVKFYLYTSSNPTKGKKITAS-TKSIDASSFNSAHPTRFVIHGWTQSYTASMNKD-- 120
            |.:.|....::|.|:...:...|.::... .:::....|||:||...:||||:.|.:|::.||  
  Rat    40 ERKPLQKPEIRFLLFKDESDRLGCQLRPQHPETLQECGFNSSHPLVMIIHGWSGSESATVGKDSD 104

  Fly   121 -------IRSAWL--------SRGD--YNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLK 168
                   :...|:        ||..  .||.:|||.......||.:|......|::||.::.:|:
  Rat   105 NDSQVDGLLETWIWKIVGALKSRQSQPVNVGLVDWISLAYQHYAIAVRNTRVVGQEVAALLLWLE 169

  Fly   169 DNHGLNLNDLYVIGHSLGAHVAGYAGKNTDG--QVHTIIGLDPALPLFSYNKPNKRLNSDDAWYV 231
            ::...:.:.:::||:||||||:|:||.:..|  ::..|.|||||.|:|....||:||:.|||.:|
  Rat   170 ESMKFSRSKVHLIGYSLGAHVSGFAGSSMGGKRKIGRITGLDPAGPMFEGTSPNERLSPDDANFV 234

  Fly   232 ESIQT-----NGGTLGFLKPIGKGAFYPNGGKTQPGC------------GLDL---TGACSHGRS 276
            ::|.|     .|.::|..:||....||||||..||||            ||:.   |..|:|.||
  Rat   235 DAIHTFTREHMGLSVGIKQPIAHYDFYPNGGSFQPGCHFLELYKHIAEHGLNAITQTIKCAHERS 299

  Fly   277 TTYYAEAVSEDN 288
            ...:.:::...|
  Rat   300 VHLFIDSLQHSN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 83/263 (32%)
LipcXP_006243421.1 Lipase 18..366 CDD:278576 85/272 (31%)
Pancreat_lipase_like 47..362 CDD:238363 83/265 (31%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338952
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.