DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and LIPH

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:278 Identity:96/278 - (34%)
Similarity:145/278 - (52%) Gaps:31/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TTVPVKFYLYTSSNPTKGKKITASTKSIDASSF---NSAHPTRFVIHGW--TQSYTASMNKDIRS 123
            |.:.|:..|||..|.|       ..::|::|:|   |....|.|::||:  |.|....|: |:..
Human    37 TGLNVRLMLYTRKNLT-------CAQTINSSAFGNLNVTKKTTFIVHGFRPTGSPPVWMD-DLVK 93

  Fly   124 AWLSRGDYNVIVVDWARARSVDYATSVLAVAATGK--KVAKMINFLKDN---HGLNLNDLYVIGH 183
            ..||..|.||:||||.|.     ||:::...|:.|  |||.::....|.   .|.:|:|:|:||.
Human    94 GLLSVEDMNVVVVDWNRG-----ATTLIYTHASSKTRKVAMVLKEFIDQMLAEGASLDDIYMIGV 153

  Fly   184 SLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNK-RLNSDDAWYVESIQTNGGTLGFLKPI 247
            |||||::|:.|:..||.:..|.|||||.|||: .||:: ||:..||.:|:.|.::...||:.:|:
Human   154 SLGAHISGFVGEMYDGWLGRITGLDPAGPLFN-GKPHQDRLDPSDAQFVDVIHSDTDALGYKEPL 217

  Fly   248 GKGAFYPNGGKTQPGCGLDLTGA-----CSHGRSTTYYAEAVSED-NFGTMKCGDYEEAVSKECG 306
            |...||||||..||||...:.|.     |.|.||...|..::.|. ......|..|::..:.:|.
Human   218 GNIDFYPNGGLDQPGCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKCV 282

  Fly   307 STYSSVRMGADTNAYMVE 324
            |..:|.:.......|..:
Human   283 SCGTSQKESCPLLGYYAD 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 95/274 (35%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 95/276 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145265
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9151
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.