DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_035258.2 Gene:Pnliprp2 / 18947 MGIID:1336202 Length:482 Species:Mus musculus


Alignment Length:264 Identity:86/264 - (32%)
Similarity:128/264 - (48%) Gaps:24/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VPVKFYLYTSSNPTKGKKITAS-TKSIDASSFNSAHPTRFVIHGWTQSYTASMNKDIRSAWLSRG 129
            :..:|.|||:.||...:.|:|: ..:|:||:|.....|||:|||:..........|:........
Mouse    65 IDTRFLLYTNENPNNYQIISATDPATINASNFQLDRKTRFIIHGFIDKGEEGWLLDMCKKMFQVE 129

  Fly   130 DYNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLGAHVAGYAG 194
            ..|.|.|||.|....:|..:.......|.::|.::..|....|.:..::::||||||:||||.||
Mouse   130 KVNCICVDWKRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGSHVAGEAG 194

  Fly   195 KNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTL------GFLKPIGKGAFY 253
            :..:|.|..|.|||||.|.|.......||:..||.:|:.|.|:...:      |..:.:|...|:
Mouse   195 RRLEGHVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFF 259

  Fly   254 PNGGKTQPGCG-------LDLTG---------ACSHGRSTTYYAEAV-SEDNFGTMKCGDYEEAV 301
            |||||..|||.       :|:.|         ||:|.||..|||.:: :.|.|....|..||:..
Mouse   260 PNGGKEMPGCQKNILSTIVDINGIWEGTRNFAACNHLRSYKYYASSILNPDGFLGYPCSSYEKFQ 324

  Fly   302 SKEC 305
            ..:|
Mouse   325 HNDC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 86/262 (33%)
Pnliprp2NP_035258.2 Lipase 31..367 CDD:278576 86/264 (33%)
Pancreat_lipase_like 65..363 CDD:238363 86/264 (33%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 106..118 3/11 (27%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 270..292 2/21 (10%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835370
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.