DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_061362.1 Gene:Pnliprp1 / 18946 MGIID:97723 Length:473 Species:Mus musculus


Alignment Length:289 Identity:97/289 - (33%)
Similarity:135/289 - (46%) Gaps:36/289 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AEQWMEAQELLESRGLTTVP-------VKFYLYTSSNPTKGKKITASTKS-IDASSFNSAHPTRF 104
            ||.|...    ..|.|..:|       .:|.|||:.|||..:.:..|..| |:||:|..|..|||
Mouse    31 AEPWAGT----AIRPLKLLPWSPEKINTRFLLYTNENPTAFQTLQLSDPSTIEASNFQVARKTRF 91

  Fly   105 VIHGWTQSYTASMNKDIRSAWLSRGDYNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKD 169
            :|||:......:...|:........:.|.|.|||.|.....|..:...|...|.:||:||:.|..
Mouse    92 IIHGFIDKGEENWVVDMCKNMFQVEEVNCICVDWKRGSQTTYTQAANNVRVVGAQVAQMIDILVR 156

  Fly   170 NHGLNLNDLYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESI 234
            |...:.:.:::|||||||||||.||..|.| :..|.||||....|.......||:..||.:|:.|
Mouse   157 NFNYSASKVHLIGHSLGAHVAGEAGSRTPG-LGRITGLDPVEANFEGTPEEVRLDPSDADFVDVI 220

  Fly   235 QTNGGTL------GFLKPIGKGAFYPNGGKTQPGCG-------LDLTG---------ACSHGRST 277
            .|:...|      |..:.:|...|:||||:..|||.       :|:.|         ||:|.||.
Mouse   221 HTDAAPLIPFLGFGTNQMVGHFDFFPNGGQYMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSY 285

  Fly   278 TYYAEAV-SEDNFGTMKCGDYEEAVSKEC 305
            .||.|:: :.|.|....|..|.:..|.:|
Mouse   286 KYYLESILNPDGFAAYPCASYRDFESNKC 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 91/262 (35%)
Pnliprp1NP_061362.1 Lipase 18..353 CDD:278576 97/289 (34%)
Pancreat_lipase_like 52..349 CDD:238363 91/264 (34%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835360
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.