DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and Lipc

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_006510879.1 Gene:Lipc / 15450 MGIID:96216 Length:526 Species:Mus musculus


Alignment Length:333 Identity:94/333 - (28%)
Similarity:156/333 - (46%) Gaps:62/333 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SRGLTTVPVKFYLYTSSNPTKGKKITAS-TKSIDASSFNSAHPTRFVIHGWTQSYTASMNKD--- 120
            |:.|.....:|.|:...|...|.::... .:::....|||:.|...:||||:.|.:|::.||   
Mouse    41 SKPLKKPETRFLLFQDENDRLGCRLRPQHPETLQECGFNSSQPLIMIIHGWSGSESATVGKDSDS 105

  Fly   121 --------------IRSAWLSRGD--YNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKD 169
                          |.||..||..  .||.:|||.......|..:|......|:.||.::.:|::
Mouse   106 DYQVDGLLENWIWKIVSALKSRQSQPVNVGLVDWISLAYQHYTIAVQNTRIVGQDVAALLLWLEE 170

  Fly   170 NHGLNLNDLYVIGHSLGAHVAGYAGKNTDG--QVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVE 232
            :...:.:.:::||:||||||:|:||.:.||  ::..|.|||||.|:|....||:||:.|||.:|:
Mouse   171 SAKFSRSKVHLIGYSLGAHVSGFAGSSMDGKNKIGRITGLDPAGPMFEGTSPNERLSPDDANFVD 235

  Fly   233 SIQT-----NGGTLGFLKPIGKGAFYPNGGKTQPGC------------GLDL---TGACSHGRST 277
            :|.|     .|.::|..:||....||||||..||||            ||:.   |..|:|.||.
Mouse   236 AIHTFTREHMGLSVGIKQPIAHYDFYPNGGSFQPGCHFLELYKHIAEHGLNAITQTIKCAHERSV 300

  Fly   278 TYYAEAVSEDNFGTM--KC---GDYEEAVSKEC--------GSTYSSVRMGADTNAYMVEGDYYV 329
            ..:.:::...:..::  :|   |.:.:.:...|        |......|.|.....:::      
Mouse   301 HLFIDSLQHSDLQSIGFQCSDMGSFSQGLCLSCKKGRCNTLGYDIRKDRSGKSKRLFLI------ 359

  Fly   330 PVNSKAPF 337
             ..:::||
Mouse   360 -TRAQSPF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 90/319 (28%)
LipcXP_006510879.1 Lipase 18..366 CDD:333880 92/331 (28%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835350
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.