DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and LIPI

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001289927.1 Gene:LIPI / 149998 HGNCID:18821 Length:460 Species:Homo sapiens


Alignment Length:307 Identity:96/307 - (31%)
Similarity:144/307 - (46%) Gaps:50/307 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 WVDMDVAEQWMEAQEL-----LESRGLTTVPVKFYLYTSSNPTKGKKITASTKSIDASSFNSAHP 101
            ||..|.....:|..:|     .....:..:.....:||.:|....:.:.....|::. :||:...
Human    12 WVRSDNKRPCLEFSQLSVKDSFRDLFIPRIETILMMYTRNNLNCAEPLFEQNNSLNV-NFNTQKK 75

  Fly   102 TRFVIHG---------WTQSYTASMNKDIRSAWLSRGDYNVIVVDWARARSVDYATSVL---AVA 154
            |.::|||         |.|::...:        |:..|.|||||||:|.     ||:.:   ||.
Human    76 TVWLIHGYRPVGSIPLWLQNFVRIL--------LNEEDMNVIVVDWSRG-----ATTFIYNRAVK 127

  Fly   155 ATGKKVAKMI-----NFLKDNHGLNLNDLYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLF 214
            .| :|||..:     |.||  ||.:|::.:.||.|||||::|:.||...||:..|.|||||.|.|
Human   128 NT-RKVAVSLSVHIKNLLK--HGASLDNFHFIGVSLGAHISGFVGKIFHGQLGRITGLDPAGPRF 189

  Fly   215 SYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPNGGKTQPGCGLDLTGA-----CSHG 274
            |...|..||:..||.:|:.|.::...||..:|:|...||||||..||||...:...     |:|.
Human   190 SRKPPYSRLDYTDAKFVDVIHSDSNGLGIQEPLGHIDFYPNGGNKQPGCPKSIFSGIQFIKCNHQ 254

  Fly   275 RST-TYYAEAVSEDNFGTMKCGDYEE-----AVSKECGSTYSSVRMG 315
            |:. .:.|...:..||.:..|..|::     .|..:|....|..|:|
Human   255 RAVHLFMASLETNCNFISFPCRSYKDYKTSLCVDCDCFKEKSCPRLG 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 91/276 (33%)
LIPINP_001289927.1 Pancreat_lipase_like 41..309 CDD:238363 91/278 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145325
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.