DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and LOC101884800

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_005174466.1 Gene:LOC101884800 / 101884800 -ID:- Length:530 Species:Danio rerio


Alignment Length:363 Identity:98/363 - (26%)
Similarity:148/363 - (40%) Gaps:82/363 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLILAFFALAASAIPIKESERVHGENGWYVPQEDGTS-------EWVDMDVAEQWMEAQELLESR 61
            :|:|..|:|.||......:|.....|  :....|..|       |:.|.|:.             
Zfish     7 WLLLMGFSLIASEPIFNSTEEAFASN--FTDYSDIESKFSIRSVEFPDEDLC------------- 56

  Fly    62 GLTTVPVKFYLYTSSNPTKGKKITASTKSIDASSFNSAHPTRFVIHGWTQS--YTASMNKDIRSA 124
                     ||           :.....||...:|.:...|..:||||:.:  :.:.:.|.:.:.
Zfish    57 ---------YL-----------VPGQQDSISDCNFKNDSQTFLIIHGWSVAGLFESWVYKLVTAL 101

  Fly   125 WLSRGDYNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLN--LNDLYVIGHSLGA 187
            :......|||||||....:..|..|.......|..|||.:|:|::   |:  |..::::|:||||
Zfish   102 YDREPSANVIVVDWLDRANKHYPKSAENTRLVGADVAKFVNWLEE---LDYPLEKVHLLGYSLGA 163

  Fly   188 HVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTN--GG---TLGFLKPI 247
            ||||.||..|:.:||.|.|||||.|.|......:||:.|||.:|:.:.||  |.   ::|..:|:
Zfish   164 HVAGVAGNLTNNKVHRITGLDPAGPSFENADILRRLSPDDASFVDVLHTNTRGSPDLSIGIQRPV 228

  Fly   248 GKGAFYPNGGKTQPGC---------------GLDLTGACSHGRSTTYYAEAV------------- 284
            |....|||||..||||               .:|....|||.||...:.:::             
Zfish   229 GHVDIYPNGGTFQPGCSIQHTMKLIATCGIYNMDQIVKCSHERSIHLFIDSLVNQAYQSWAFRCA 293

  Fly   285 SEDNFGTMKCGDYEEAVSKECGSTYSSVRMGADTNAYM 322
            |.|:|....|....:......|.....:|....|..|:
Zfish   294 SRDSFNKGLCLSCRKNRCNTLGYNVKKIRSTRSTKMYL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 85/292 (29%)
LOC101884800XP_005174466.1 lipo_lipase 35..473 CDD:132274 90/333 (27%)
Pancreat_lipase_like 39..335 CDD:238363 89/329 (27%)
PLAT 342..464 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.