DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and lipg

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002934486.2 Gene:lipg / 100498513 XenbaseID:XB-GENE-1011639 Length:500 Species:Xenopus tropicalis


Alignment Length:308 Identity:94/308 - (30%)
Similarity:153/308 - (49%) Gaps:51/308 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VKFYLYTSSNPTKGKKITASTKSIDASSFNSAHPTRFVIHGWTQSYTASMNKDIRSAWL------ 126
            |:|.::.|...:....|....:.:...::|::..|..|||||:.|       .:...||      
 Frog    53 VRFNVHFSKYDSGCFLIPGQEECLGNCNYNTSAKTFIVIHGWSMS-------GLFETWLHRLVGA 110

  Fly   127 --SRGDY-NVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLGAH 188
              .|..| |||||||.......|..:|......||.:|.::::|::...|:|.::::||:|||||
 Frog   111 LQERERYANVIVVDWMNLAHQLYPDAVNNTMVVGKDIAVLMDWLQEKANLSLENVHLIGYSLGAH 175

  Fly   189 VAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTN-----GGTLGFLKPIG 248
            ||||||....|::..|.|||||.|:|...:.:|||:.|||.:|:.:.|.     |.::|...|||
 Frog   176 VAGYAGNFVTGRIGRITGLDPAGPMFEGAEAHKRLSPDDADFVDVLHTYTREALGVSIGIQMPIG 240

  Fly   249 KGAFYPNGGKTQPGCGL-DLTGA-----------CSHGRSTTYYAEAV---SEDNFGTMKCGD-- 296
            ....|||||..|||||| |:.||           |.|.||...:.:::   .:::| ..:|.|  
 Frog   241 HIDIYPNGGDFQPGCGLSDVLGAIAYGSIGDAVKCEHERSVHLFVDSLIHKDQESF-AFQCTDSD 304

  Fly   297 -YEEAVSKECGST------YSSVRMGADTNAYMVEGDYYVPVNSKAPF 337
             :::.:...|...      |::.||.:..|:.|     ::...::.|:
 Frog   305 RFKKGICLSCRKNRCNAIGYNAKRMRSKRNSKM-----FLKTRAQMPY 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 93/302 (31%)
lipgXP_002934486.2 lipo_lipase 63..488 CDD:132274 91/298 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.