DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and pnliprp3

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_031761690.1 Gene:pnliprp3 / 100487975 XenbaseID:XB-GENE-6250474 Length:420 Species:Xenopus tropicalis


Alignment Length:269 Identity:88/269 - (32%)
Similarity:129/269 - (47%) Gaps:28/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VPVKFYLYTSSNPTKGKKITASTKSIDASSFNSAHPTRFVIHGWTQSYTASMNKDIRSAWLSRGD 130
            :..:::|.|..||...::| .|..|:..|:|.....|||:|||:..:.......::....|...|
 Frog     6 INTRYFLVTRENPDYFQEI-ISHSSVSTSNFKPNRKTRFIIHGFVNTAERGWQMEMCQVMLEVED 69

  Fly   131 YNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLGAHVAGYAGK 195
            .|...:||.......|..:...:...|.::|..|.:|..|:..:.:.:::|||||||||||.|||
 Frog    70 VNCFCIDWRGGSFTLYTQAANNIRVVGAELASFIGYLSKNYDYSPSMIHIIGHSLGAHVAGEAGK 134

  Fly   196 NTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGT------LGFLKPIGKGAFYP 254
            ...| :..|.|||||.|||....|..||:..||.:|::|.|:...      ||..:.:|...|:|
 Frog   135 RVPG-IARISGLDPAGPLFQNTPPEVRLDPTDADFVDAIHTDTSPLIPKIGLGMAQSVGHLDFFP 198

  Fly   255 NGGKTQPGCG-------LDLTG---------ACSHGRSTTYYAEAV-SEDNFGTMKCGDYE---E 299
            |||:|.||||       ||:..         ||:|.||..||.|:: :.|.|.......||   :
 Frog   199 NGGQTMPGCGSNIITRLLDIEELWGGADNYLACNHLRSYKYYTESIRTPDAFVAFPSDTYEAFMK 263

  Fly   300 AVSKECGST 308
            .....|.||
 Frog   264 GTGFPCPST 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 88/267 (33%)
pnliprp3XP_031761690.1 Lipase 2..304 CDD:395099 88/269 (33%)
PLAT 307..417 CDD:412108
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.