DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and LOC100331214

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:331 Identity:96/331 - (29%)
Similarity:155/331 - (46%) Gaps:64/331 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 WVDMDVAEQWMEAQE------------LLESRGLTTVP---VKFYLYTSSNP-------TKGKKI 84
            |:.:::...::.|.|            |.:.|.|:.|.   |||.|...|.|       .:||  
Zfish    12 WLVLNITGPFIAALEEGNVLNGVFDHFLEDLRDLSDVKKLNVKFSLRNPSQPDDDVCYIVRGK-- 74

  Fly    85 TASTKSIDASSFNSAHPTRFVIHGWTQS--YTASMNKDIRSAWLSRGDYNVIVVDWARARSVDYA 147
               .:::.:.:||....|..||||||.|  :.:.:.|.:.:.:....|.|||||||.......|.
Zfish    75 ---AETLSSCNFNHTSKTILVIHGWTVSGLFESWVEKLVAALYNREKDANVIVVDWLDTAQDHYV 136

  Fly   148 TSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALP 212
            .:.......|:::...|:::::...:.|.:|::||:||||||||:||.:|..::..|.|||||.|
Zfish   137 VAAQNTKMVGREIGLFIDWIEETSNVPLENLHLIGYSLGAHVAGFAGSHTTNKIGRITGLDPAGP 201

  Fly   213 LFSYNKPNKRLNSDDAWYVESIQT-----NGGTLGFLKPIGKGAFYPNGGKTQPGCGLDLTGA-- 270
            .|.....:.||:.|||.:|:.:.|     .|.::|..:|:|....|||||..||||  :|.||  
Zfish   202 DFEGVHAHGRLSPDDAHFVDVLHTFTRGSLGLSIGIEQPVGHVDIYPNGGSFQPGC--NLRGALE 264

  Fly   271 ---------------CSHGRSTTYYAEA-VSEDNFG-TMKCGD---YEEAVSKECGSTYSSVRMG 315
                           |.|.||...:.:: ::|:..| ...||.   ::..|..:|.      :.|
Zfish   265 KMASYGIFAINNAIRCEHERSIHLFIDSLLNEEAAGRAYSCGSNDMFDRGVCLQCR------KNG 323

  Fly   316 ADTNAY 321
            .:|..|
Zfish   324 CNTVGY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 89/290 (31%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 90/296 (30%)
Pancreat_lipase_like 51..347 CDD:238363 89/292 (30%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578511
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.