DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and lpl

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002934038.1 Gene:lpl / 100127862 XenbaseID:XB-GENE-951545 Length:483 Species:Xenopus tropicalis


Alignment Length:302 Identity:89/302 - (29%)
Similarity:138/302 - (45%) Gaps:37/302 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LESRGLTTVPVKFYLYTSSNPTKGK--KITASTKSIDASSFNSAHPTRFVIHGWTQS--YTASMN 118
            |:.....::..||.|.|...|....  .:.....::|..:||....|..||||||.:  :.:.:.
 Frog    37 LKKTDFNSIESKFSLRTLEEPDDDTCYLVPGQEHTVDQCNFNHTSKTFVVIHGWTVTGMFESWVP 101

  Fly   119 KDIRSAWLSRGDYNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGH 183
            |.:.:.:....|.|||||||.......|..|.......|:.||..|:::.|.....:::::::|:
 Frog   102 KLVDALYKREPDSNVIVVDWLTRAQQHYPVSAEYTQLVGQDVASFIDWMDDTIQYPIDNIHILGY 166

  Fly   184 SLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQ--TNGG---TLGF 243
            |||||.||.||..|:.:|:.|.|||||.|.|.|.:....|:.|||.:|:.:.  |.|.   ::|.
 Frog   167 SLGAHAAGVAGSLTNKKVNRITGLDPAGPTFEYAENAIILSPDDAEFVDVLHTYTRGSPDRSIGI 231

  Fly   244 LKPIGKGAFYPNGGKTQPGCGL---------------DLTGACSHGRSTTYYAEAVSEDNFGTM- 292
            .||:|....|||||..||||.|               |....|||.||...:.:::..:...:| 
 Frog   232 QKPVGHIDIYPNGGSFQPGCNLGEALRLIAEKGFGDVDQLVKCSHERSIHLFIDSLLYEEKPSMA 296

  Fly   293 -KCGD---YEEAVSKEC--------GSTYSSVRMGADTNAYM 322
             :|..   :|:.:...|        |...:.||....|..|:
 Frog   297 YRCNSKEAFEKGLCLSCRKNRCNTLGYKVNKVRGKRSTKMYL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 88/292 (30%)
lplXP_002934038.1 lipo_lipase 41..476 CDD:132274 88/298 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.