DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and lipib

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_001342691.1 Gene:lipib / 100003046 ZFINID:ZDB-GENE-091118-47 Length:448 Species:Danio rerio


Alignment Length:286 Identity:83/286 - (29%)
Similarity:137/286 - (47%) Gaps:34/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QEDGTSEWVDMDVAEQWMEAQELLESRGLTTVPVKFYLYTSSNPTKGKKITASTKSIDASSFNSA 99
            :::....:.|:|..|.::.          |.:.|:..|||.:|...|:::.....: ....||..
Zfish    19 EDNDCDNFTDLDFHESFIG----------TNLYVRLLLYTRANLECGQELPHHNFT-QQPLFNVT 72

  Fly   100 HPTRFVIHGWTQSYTASMNKDIRSAWL--------SRGDYNVIVVDWAR-ARSVDYATSVLAVAA 155
            .||.|||||:..:....:       |:        ::.|.|::||||.| |.:::|.|:|.....
Zfish    73 RPTTFVIHGYRPTGAPPI-------WINHIVHLLAAQKDMNILVVDWNRGAANLNYLTAVANTRG 130

  Fly   156 TGKKVAKMINFLKDNHGLNLNDLYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPN 220
            |...:.:.|..: :..|.:|:.:::||.||||||||:.|....|:|..|.|||||.|:|:...|.
Zfish   131 TALNITRFIESM-EKEGASLDSIHLIGVSLGAHVAGFIGAMLGGRVGRITGLDPAGPMFASVSPE 194

  Fly   221 KRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPNGGKTQPGCGLDLTG-----ACSHGRSTTYY 280
            :||:..||.:|:.:.|:..:.|.....|...||.|||..||||...:..     .|.|.||...|
Zfish   195 ERLDPTDAQFVDVLHTDMNSFGLRGTHGHIDFYANGGLDQPGCPKTIFSGKSYFVCDHQRSVFLY 259

  Fly   281 AEAVSED-NFGTMKCGDYEEAVSKEC 305
            ..:::.. :.....|..|.:.:|.:|
Zfish   260 LCSLNRTCSLTGYPCSSYSDFLSGQC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 79/253 (31%)
lipibXP_001342691.1 Lipase 37..328 CDD:278576 80/268 (30%)
Pancreat_lipase_like 40..324 CDD:238363 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578541
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9151
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.