DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:270 Identity:84/270 - (31%)
Similarity:123/270 - (45%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RISTNAVNFYVYTKSNPTDGKEIKAKSG-SVEDSHFNKDHGTRFVIHGWTQRYSDDMNTRITKAW 122
            :|:|   .|.:||..|||..:.::.... ::..|:|.....|||:|||:..:..::....:.|..
  Rat    51 KINT---RFLLYTNENPTAFQTLQLSDPLTIGASNFQVARKTRFIIHGFIDKGEENWVVDMCKNM 112

  Fly   123 LSKGDYNVIVVDWARARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAHVA 187
            ....:.|.|.|||.:.....|..:...|...|.:|.:||..|..::......:.:||||||||||
  Rat   113 FQVEEVNCICVDWKKGSQTTYTQAANNVRVVGAQVAQMIDILVKNYSYSPSKVHLIGHSLGAHVA 177

  Fly   188 GYAG-KTVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKL------GFLKPI 245
            |.|| :|.|..|   |.||||....|.......||...||.:|:.|.|:...|      |..:..
  Rat   178 GEAGSRTPGLGR---ITGLDPVEANFEGTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQMS 239

  Fly   246 GKGAFYPNGGKSQPGCGLDATG----------------SCSHARSVLYYAEAV-TEDNFGSIKCH 293
            |...|:||||:|.|||..:|..                :|:|.||..||.|:: ..|.|.:..|.
  Rat   240 GHLDFFPNGGQSMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESILNPDGFAAYPCA 304

  Fly   294 DYEDAVAKNC 303
            .|:|..:..|
  Rat   305 SYKDFESNKC 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 82/264 (31%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 84/270 (31%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338964
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.