DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and CG34447

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster


Alignment Length:295 Identity:84/295 - (28%)
Similarity:136/295 - (46%) Gaps:19/295 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 MEGRISTNAVNFYVYTKSNPTDGKEIKAKSGSVEDSHFNKDHGTRFVIHGWTQRYSDDMNTRITK 120
            :.|......::|::|  ||.|....|......:...:|......:.:|||:|.......|:.|..
  Fly    33 VRGECPNKNISFWLY--SNSTRENPILLDPLDLNPWNFQPPRPLKILIHGYTGDRDFAPNSYIRP 95

  Fly   121 AWLSKGDYNVIVVDWA-RARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGA 184
            ..|...|..||.:|:. ..|...|..:|..:|.....:.::|..|.|...:..|.:.:||.|||.
  Fly    96 VLLDHEDVYVISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGG 160

  Fly   185 HVAGYAGKTVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKLGFLKPIGKGA 249
            .|||.....| .:::..|.|||||.|||.....::||...||.:|:.|.|:....|:|:..|...
  Fly   161 QVAGQTANYV-KRKMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTDVFGRGYLRAAGHVD 224

  Fly   250 FYPNGGKSQPGC---GLDATGSCSHARSVLYYAEAV-TEDNFGSIKCHDYEDAVAKNCGSTYSSV 310
            ||||.|..||||   .:....||:|.|:..:|||:: |...|.:.:|..:...:...|.:|.:..
  Fly   225 FYPNFGAKQPGCMEENMQDPSSCNHERAPRFYAESINTTVGFWARQCSGWLLQLLTLCPTTGAQA 289

  Fly   311 RMGAITNAYMV----EGDFYVPVNSEAPF--GKIE 339
            .:|     |.|    .|.:::...|::|:  ||::
  Fly   290 LLG-----YHVSDELRGSYFLQTASKSPYALGKMQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 79/274 (29%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 79/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445920
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.