DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and PNLIPRP2

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_005387.3 Gene:PNLIPRP2 / 5408 HGNCID:9157 Length:469 Species:Homo sapiens


Alignment Length:261 Identity:84/261 - (32%)
Similarity:119/261 - (45%) Gaps:25/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 FYVYTKSNPTDGKEIK-AKSGSVEDSHFNKDHGTRFVIHGWTQRYSDDMNTRITKAWLSKGDYNV 130
            |.:||..||.:.:.|. .:..::|.|:|..|..|||:|||:..:..|...:.:.|........|.
Human    56 FLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNC 120

  Fly   131 IVVDWARARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAHVAGYAGKTVG 195
            |.|||.......|..:|..:...|.:...:|:.|....|...:.:.|||||||||.|..||:.:|
Human   121 ICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLG 185

  Fly   196 DKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKL------GFLKPIGKGAFYPNG 254
            . ||..|.|||||.|.|..:....||...||.:|:.|.|:...:      |..:.:|...|:|||
Human   186 G-RVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNG 249

  Fly   255 GKSQPGC----------------GLDATGSCSHARSVLYYAEAV-TEDNFGSIKCHDYEDAVAKN 302
            ||..|||                |:....||:|.||..||:.:| ..|.|....|..|::.....
Human   250 GKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESK 314

  Fly   303 C 303
            |
Human   315 C 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 84/261 (32%)
PNLIPRP2NP_005387.3 Lipase 18..354 CDD:395099 84/261 (32%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 93..105 4/11 (36%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 257..279 1/21 (5%)
PLAT_PL 357..469 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.