DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and PNLIPRP1

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001290064.1 Gene:PNLIPRP1 / 5407 HGNCID:9156 Length:467 Species:Homo sapiens


Alignment Length:262 Identity:84/262 - (32%)
Similarity:119/262 - (45%) Gaps:28/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 FYVYTKSNPTDGKEIKAKSGS-VEDSHFNKDHGTRFVIHGWTQRYSDDMNTRITKAWLSKGDYNV 130
            |.:||..||.:.:.:.....| :|.|:|..|..|||:|||:..:..:...|.:.|......:.|.
Human    56 FLLYTNENPNNFQILLLSDPSTIEASNFQMDRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNC 120

  Fly   131 IVVDWARARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAHVAGYAG-KTV 194
            |.|||.:.....|..:...|...|.:|.:|:..|...:......:.:|||||||||||.|| ||.
Human   121 ICVDWKKGSQATYTQAANNVRVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEAGSKTP 185

  Fly   195 GDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKL------GFLKPIGKGAFYPN 253
            |..|   |.||||....|.......||...||.:|:.|.|:...|      |..:.:|...|:||
Human   186 GLSR---ITGLDPVEASFESTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQQMGHLDFFPN 247

  Fly   254 GGKSQPGCGLDATG----------------SCSHARSVLYYAEAV-TEDNFGSIKCHDYEDAVAK 301
            ||:|.|||..:|..                :|:|.||..||.|:: ..|.|.:..|..|:...:.
Human   248 GGESMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESILNPDGFAAYPCTSYKSFESD 312

  Fly   302 NC 303
            .|
Human   313 KC 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 84/262 (32%)
PNLIPRP1NP_001290064.1 Lipase 18..353 CDD:278576 84/262 (32%)
Pancreat_lipase_like 52..349 CDD:238363 84/262 (32%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145287
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.