DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and sxe2

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster


Alignment Length:318 Identity:95/318 - (29%)
Similarity:157/318 - (49%) Gaps:41/318 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 MEGRISTNA--------------VNFYVYTKSNPTDGKEIK-AKSGSVEDSHFNKDHGTRFVIHG 105
            ::|.|:|.|              :.:.:||..||.:.:.:: .....:.:||||.....|..|||
  Fly    48 IQGMITTEAGVILGRPRPSQTKLLRYDLYTPLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIHG 112

  Fly   106 WTQRYSDDMNTRITKAWLSKGDYNVIVVDWAR-ARSVDYASSVLAVPGAGGKVGEMIKYLHDHHG 169
            |..:.....|..|..|:||:|:||||::||:| :..:.|......:|.....|.:|:::|||:.|
  Fly   113 WAGKSVTCSNAAIKDAYLSRGNYNVIILDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLHDNTG 177

  Fly   170 LDYDSLEVIGHSLGAHVAGYAGKTVGDKRVHTIVGLDPA-LPLFSYDKPAKRLSTDDAHYVESIQ 233
            :.|:.:.:||||.|:|::|..||.:...|:..|..|||| |...|.. |.:||..:||.|||||.
  Fly   178 VPYEQIYMIGHSAGSHISGLTGKLLRPHRLGAIFALDPAGLTQLSLG-PEERLDVNDALYVESIH 241

  Fly   234 TNGGKLGFLKP---IGKGAFYPNGGKSQPGCGLDATGS-----CSHARSVLYYAEAVTE-DNFGS 289
            |:...||  .|   :...:|:.|.|..||.|. :||.:     |.|..::.|:||:|.: .:|.:
  Fly   242 TDLTLLG--NPSTKLSHASFFANWGLGQPHCP-NATATEFDFVCDHFAAMFYFAESVRQPKSFAA 303

  Fly   290 IKCHDYEDAVAKNCGSTYSSVRMGAIT----NAYM-------VEGDFYVPVNSEAPFG 336
            ::|...:..::..|..........|:.    |.:|       ..|.||:....::|:|
  Fly   304 LRCSSAKSVLSATCNCNVGGSEKYAVNTCTGNEFMGGEPAVPKRGIFYLSTRPQSPYG 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 89/288 (31%)
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 91/310 (29%)
Pancreat_lipase_like 72..356 CDD:238363 89/287 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.