DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and CG10116

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:280 Identity:80/280 - (28%)
Similarity:130/280 - (46%) Gaps:31/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 FYVYTKSNPTDGKEIKAKSGSVEDSHFNKDHGTRFVIHGWTQRYSDDMNTRITKAWLSKGDYNVI 131
            |::.|:....:.:.|:|:..::..|.|.....|...|..|....|......:..|.|.:.|.|:|
  Fly    24 FFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNII 88

  Fly   132 VVDWARARS----VDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAHVA-GYAG 191
            .||.:.|..    :|..:|::.|             ||:...:..|.:.|:|.:.|||:| |.|.
  Fly    89 SVDLSEANDETEIIDSVASLVIV-------------LHNQFDMPLDRILVVGFAEGAHLAGGVAA 140

  Fly   192 KTVGD--KRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKLGFLKPIGKGAFYPNG 254
            |...|  :::..|..|||:    |..:...:||..||.:||.:.||.|..|..:.:|...:||||
  Fly   141 KVQQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNG 201

  Fly   255 GKSQPGCGLDATGSCSHARSVLYYAEAVT-EDNFGSIKCHDYEDAVAKNCGSTYSSVRMGAITNA 318
            |::||||   .|.||||.|:....||..: |::|.|.:|...|...|.:|  .:|:.:||.....
  Fly   202 GQTQPGC---TTDSCSHERAFELLAEMWSPENDFVSARCGSVETLSASSC--RWSTHKMGQKQEE 261

  Fly   319 YM-VEGDFYVPVNSEAPFGK 337
            .. ..|.:::.....:||.:
  Fly   262 EQPASGIYFLETRQSSPFSR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 78/272 (29%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 78/271 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445960
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.