DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and lipg

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_956422.1 Gene:lipg / 393096 ZFINID:ZDB-GENE-040426-699 Length:500 Species:Danio rerio


Alignment Length:339 Identity:93/339 - (27%)
Similarity:148/339 - (43%) Gaps:85/339 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ISTNAVNFYVYTKSNPTDGKEI----------------------KAKSGSVEDSHFNKDHGTRFV 102
            ::.:|.||:      |||...:                      ..|..|:....||....|..:
Zfish    34 LNEDAENFF------PTDSAVLHDKISYNMRKSLDLGDGACYLQPGKKESIVACGFNATLRTILI 92

  Fly   103 IHGWTQRYSDDMNTRITKAWLSK---------GDYNVIVVDWARARSVDYASSVLAVPGAGGKVG 158
            |||||.       :.:.::|:.|         .:.||:||||....:..|..:|......|..:.
Zfish    93 IHGWTM-------SGMFESWMHKLVAAVQRRESEANVVVVDWLGLANQLYPDAVNHTRRVGQSIA 150

  Fly   159 EMIKYLHDHHGLDYDSLEVIGHSLGAHVAGYAGKTVGDKRVHTIVGLDPALPLF----SYDKPAK 219
            .::.:|.:...|..:::.:||:||||||||||| |..:..:..|.|||||.|:|    ||:|   
Zfish   151 TLLDWLQEEEQLQLENVHIIGYSLGAHVAGYAG-TFVNGIIGRITGLDPAGPMFEGADSYNK--- 211

  Fly   220 RLSTDDAHYVESIQTN-----GGKLGFLKPIGKGAFYPNGGKSQPGCGLD-----ATGS------ 268
             ||.|||.:|:.:.|.     |..:|..:|||....|||||..||||...     |:|:      
Zfish   212 -LSPDDADFVDVLHTYTRGALGVSIGIQEPIGHIDIYPNGGDVQPGCTFGEFLSAASGNFMEAMK 275

  Fly   269 CSHARSV-LYYAEAVTEDNFG-SIKC---HDYEDAVAKNCGST------YSSVRMGAITNAYMVE 322
            |.|.|:| |:....:.:|:.. :.:|   ..::..:..:|...      |::.:|....|:.|  
Zfish   276 CEHERAVHLFVDSLMNKDHVSYAFQCTGPDRFKKGICLSCRKNRCNSIGYNAKKMRKRRNSKM-- 338

  Fly   323 GDFYVPVNSEAPFG 336
               |:...::.|||
Zfish   339 ---YLKTRADTPFG 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 89/327 (27%)
lipgNP_956422.1 lipo_lipase 55..488 CDD:132274 87/312 (28%)
Pancreat_lipase_like 65..344 CDD:238363 84/295 (28%)
PLAT_LPL 351..486 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.