DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and CG13562

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:347 Identity:73/347 - (21%)
Similarity:119/347 - (34%) Gaps:83/347 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LDGSFEWMDMQDA------------EDLLANGAQMEGRISTNA-----VNFYVYTKSNPTDGKEI 81
            :||:...::::.|            .|.||:    :.||..:|     |.||    .|.|...|.
  Fly    19 IDGTHSKLNLKYAILRQKQAAKATQNDTLAH----QQRIKYDAQKTMKVMFY----KNNTKTMET 75

  Fly    82 KAKSGSVEDSHFNKDHGTRF--VIHGWTQRYSDDMNTRITKAW----LSKGDYN----VIVVDWA 136
            .|...:.:.|........:|  |:|||.|..||:        |    :.:..|.    ||.:|::
  Fly    76 SAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCSDE--------WALSLIERLSYYRGGCVICIDYS 132

  Fly   137 RARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAHVAGYAGKTVGDKRVHT 201
            ...|..|...........|.:..:|..|. ..|.|.....:.|.|.|..:|...|:::   |.|.
  Fly   133 VVASSSYMRLYTNFDTLTGAISSIILTLF-RQGFDPKRGYMFGFSFGGQLASAVGRSL---RPHH 193

  Fly   202 IV-----------GLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKLGFLKPIGKGAFYPNGG 255
            |:           |.||.  ...:.|..|        :|:...::..|..|:....:.....:.|
  Fly   194 IIESIDTCDMAGPGFDPI--AVDHSKAGK--------HVQCFHSSRDKGTFVYSCHRNIMLGSCG 248

  Fly   256 KSQPGCG----LDATGSC--SHARSVLYYAEAVTEDNFGSIKCHDYEDAVAKNCGSTYSSVRMGA 314
            ..||...    |.:.|.|  .:..:..|...||   |:...:|..::.......|.|     :|.
  Fly   249 LKQPSVASQLHLGSHGLCVDIYINTFDYPFYAV---NYTPPECFTWQKTAKIPDGYT-----VGY 305

  Fly   315 ITN-AYMVEGDFYVPVNSEAPF 335
            ..| ...|.|..:||.:...|:
  Fly   306 EENFDSQVTGQIFVPTSLHYPY 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 63/293 (22%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 35/159 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.