DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and CG6675

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster


Alignment Length:294 Identity:107/294 - (36%)
Similarity:151/294 - (51%) Gaps:43/294 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VNFYVYTKSNPTDGKEIKAKSGSVEDS--H--FNKDHGTRFVIHGWTQRYSDDMNTRITKAWLSK 125
            ::||::.:..|..|:|:   ..|:|..  |  ||....||.:||||..:.....|..:..|:|.|
  Fly   118 MHFYLFKREFPECGREV---DFSIERKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVKNAYLKK 179

  Fly   126 GDYNVIVVDW-ARARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAHVAGY 189
            |:|||||||| |.:.:::|.|.|..:...|.::.:.|:.|:...|.|:||:.:|||||||.:||.
  Fly   180 GEYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGS 244

  Fly   190 AGKTVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKLGFLKPIGKGAFYPNG 254
            |||.:...:|:||..||||.|.|.:.....|:...||.||||:.|: ...||.:|.|...||||.
  Fly   245 AGKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTS-ANFGFRRPTGSATFYPNY 308

  Fly   255 GKSQPGC---GLDATGSCSHARSVLYYAEAVT-----------EDNFGSIKCHDYEDAVAKNCGS 305
            |..|..|   |      |||.||...:||::.           .|| |..:| ||         |
  Fly   309 GAYQHSCYYLG------CSHIRSYQMFAESINSPLGFWGTPCIRDN-GRWQC-DY---------S 356

  Fly   306 TYSSVRMGAITNAYMVEGDFYVPVNSEAPF--GK 337
            ...|::|....:.:. ||.|||..:|..||  ||
  Fly   357 QRQSIQMAGEPSIHK-EGIFYVKTSSSDPFALGK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 102/284 (36%)
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 102/284 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438420
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D81025at33392
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.