DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and CG13282

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:287 Identity:92/287 - (32%)
Similarity:137/287 - (47%) Gaps:22/287 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VNFYVYTKSNPTDGK----EIKAKSGSVEDSHFNKDHGTRFVIHGWTQRYSDDM----NTRITKA 121
            |.:|:||:.||.|.:    :...:..::.||:||..:.|:.:|||    |:.||    ..::.:.
  Fly    77 VKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIHG----YNSDMFLHPLQQMREE 137

  Fly   122 WLSKGDYNVIVVDWA-RARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAH 185
            :|:|.|||:|.|||: .:....|.|:|.....||....::::.|.:....|   :.|||.||||.
  Fly   138 YLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVETGNTD---IHVIGFSLGAQ 199

  Fly   186 VAGYAGKTVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKLGFLKPIGKGAF 250
            |..|..:.:....:..|.|||||:|||.....|.:|...||.||:.|.||....|.::..|...|
  Fly   200 VPNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKMERCGHADF 264

  Fly   251 YPNGGKSQPGCGLDATGS--CSHARSVLYYAEAV-TEDNFGSIKCHDYEDAVAKNCGSTYSSVRM 312
            |.|||..||||......|  |||.|:..|:.|:: :...|....|..|...:...|..|...:..
  Fly   265 YMNGGIMQPGCNGQKINSFACSHQRAPAYFLESIRSPKGFWGWACSGYISYLLGMCPPTNFLLEA 329

  Fly   313 GAITNAYMVEGDFYVPVNSEAPF--GK 337
            |..... ...|.|.:..|..:||  ||
  Fly   330 GENIRP-TTRGMFMIDTNDSSPFALGK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 87/277 (31%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 88/281 (31%)
Pancreat_lipase_like 75..347 CDD:238363 87/277 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445950
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.