DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and CG17292

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster


Alignment Length:276 Identity:86/276 - (31%)
Similarity:131/276 - (47%) Gaps:41/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VEDSHFNKDHGTRFVIHGWTQRYSDDMNTR----ITKAWLSKGDYNVIVVDWARARSVDYASSVL 148
            :||.|.:....|...:||    |.:|.:..    |.:|:|.:.|.|:||:||......:|...  
  Fly    50 LEDEHLDLGKNTVLYLHG----YLEDPDVESIHVIAEAYLERKDTNLIVLDWGELADGNYMFD-- 108

  Fly   149 AVPG---AGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAHVAGYAG-----KTVGDKRVHTIVGL 205
            |.|.   .|.::.:::..:.| ||||.:...::|||:|..:||..|     :|.|.:::..|..|
  Fly   109 AFPNLKQLGPELAKVLLKMFD-HGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISAL 172

  Fly   206 DPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKLGFLKPIGKGAFYPNGGKS-QPGCG------L 263
            |||.|||   .|...||.:||.:|:.|.|:....|.....|...|:||||.| ||||.      |
  Fly   173 DPAFPLF---YPGTHLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKML 234

  Fly   264 DATGSCSHARSVLYYAEAVTE------DNFGSIKCHDY-EDAVAKNCGSTYSSVRMGAITNAYMV 321
            ......||.||..::||:|::      |...:.|..|: ::.:.:||    ..|.||..... .:
  Fly   235 SDNDLSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVENC----PPVVMGHHCPT-TI 294

  Fly   322 EGDFYVPVNSEAPFGK 337
            .||||:..|...||.:
  Fly   295 HGDFYLQTNGHTPFAR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 83/268 (31%)
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 83/267 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.