DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and CG14034

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:296 Identity:83/296 - (28%)
Similarity:141/296 - (47%) Gaps:15/296 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NGAQMEGRISTNA-VNFYVYTKSNPTDGKEIKAKSGSVEDSHFNKDH--GTRFVIHGWTQRYSDD 113
            |...::..|..|| ::|::|||.| .:|.::..    .|.:.|...|  ..:.:|||:.......
  Fly    24 NCFSLQNEICPNANISFWLYTKEN-QEGTKLSV----FELNRFEFYHHKPLKVLIHGFNGHRDFS 83

  Fly   114 MNTRITKAWLSKGDYNVIVVDWAR-ARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEV 177
            .||::...:|:: |||:|.:|:.: |....|..:|...........::::.|.:...:..:.|.:
  Fly    84 PNTQLRPLFLTQ-DYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHL 147

  Fly   178 IGHSLGAHVAGYAGKTVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKLGFL 242
            ||..|||||||:.|:.:.:.::..|..||||.|.:....||.:|...||.:|:.:.|:...||.|
  Fly   148 IGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLL 212

  Fly   243 KPIGKGAFYPNGGKSQPGCG---LDATGSCSHARSVLYYAEAVTE-DNFGSIKCHDYEDAVAKNC 303
            ..:|...||.|.|.|||.||   ...|..|.|.|:..||||:::. ..|....|.:::......|
  Fly   213 DAVGHVDFYLNMGVSQPNCGPINKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGIC 277

  Fly   304 GSTYSSVRMGAITNAYMVEGDFYVPVNSEAPFGKIE 339
            ....:...||...:. ...|.:::..|:..|:.|.|
  Fly   278 IPDKNIELMGFHVDP-KARGRYFLDTNNGPPYAKGE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 75/272 (28%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 75/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445940
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.