DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and pla1a

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_996939.1 Gene:pla1a / 334017 ZFINID:ZDB-GENE-030131-5949 Length:456 Species:Danio rerio


Alignment Length:276 Identity:80/276 - (28%)
Similarity:120/276 - (43%) Gaps:29/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 WMDMQDAEDLLANGAQMEGRISTNAVNFYVYTKSNPTDGKEIKAKSGSVEDSHFNKDHGTRFVIH 104
            |::.:.|..|......:. |.:.|..:.:.....|.|          ....::||....|:.::|
Zfish    39 WLEYRQATKLQVQYLLLT-RKNANCASLFTQDCLNHT----------QKHTAYFNSSLPTKVIVH 92

  Fly   105 GWTQRYS-DDMNTRITKAWLSKGDYNVIVVDWARARSVDYASSVLAVPGAGGKVGEMIKYLHDHH 168
            |:....| ....:.:.:|.|.:.|.||:||||....|..|...|........::..:|..| ..:
Zfish    93 GYRALGSKPSWVSGLAQALLREEDVNVLVVDWVYGASFAYNLVVENYKEVAVQISVLINQL-TKY 156

  Fly   169 GLDYDSLEVIGHSLGAHVAGYAGKTVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQ 233
            |...:|...||.||||||:|:.| |:...::..|.|||||.|:|....|..||.:.||.:||:|.
Zfish   157 GSTLESFHFIGVSLGAHVSGFVG-TLFHGKLGRITGLDPAGPMFKSADPFDRLDSSDALFVEAIH 220

  Fly   234 TNGGKLGFLKPIGKGAFYPNGGKSQPGCGLDATGS------CSHARSVLYYAEAVTEDNFGS--- 289
            |:....|...|:|...|:.|||..|.||......|      |.|.|::..|..|:.    ||   
Zfish   221 TDSDYFGISIPVGHVDFFLNGGMDQAGCARSRFASMYGYVICDHMRALHVYMSALN----GSCPL 281

  Fly   290 --IKCHDYEDAVAKNC 303
              ..|..||:.:|..|
Zfish   282 IGFPCSGYEEFLAGKC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 75/251 (30%)
pla1aNP_996939.1 Lipase 21..340 CDD:278576 80/276 (29%)
Pancreat_lipase_like 48..336 CDD:238363 78/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.