DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and CG5162

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster


Alignment Length:372 Identity:107/372 - (28%)
Similarity:172/372 - (46%) Gaps:57/372 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLAALLAAVSAL--PIEERVN--GENGWFI--------PK--LDGS--------FEWMDMQDAED 48
            :|..|:|::.|:  .:.:.:|  |..|..|        |:  |:||        ||:  :.::.:
  Fly    15 LLQLLVASIHAIEWSLPDVINSIGNVGTSIVDPSLLPTPQGLLEGSKQLIAGYPFEF--VSNSLN 77

  Fly    49 LLANGAQMEGRIST------NAVNFYVYT----KSNPTDGKEIKAKSGSVEDSHFNKDHGTRFVI 103
            ::.:.|....:|.:      |.:||.:.|    |:.|....|...||     ..|:.......:.
  Fly    78 VICSQALASNKIKSKYSPDINKMNFQLQTACEKKNFPLTSPESMWKS-----PLFDVKKKVVILA 137

  Fly   104 HGWTQRY--SDDMNTRITKAWLSKGDYNVIVVDWARARSVDYASSVLAVPGAGGKVGEMIKYLHD 166
            .|||...  ||.:.. .:||:..:||.|.:.||.||.....|..|.......|..:...:..|.|
  Fly   138 TGWTTTVNGSDTIEV-FSKAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLD 201

  Fly   167 HHGLDYDSLEVIGHSLGAHVAGYAGK---TVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHY 228
            .  :..:::.:||||||||:.|.||:   .:.::.:..|.|||||.|.|:..:....|...|||:
  Fly   202 L--VPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHF 264

  Fly   229 VESIQTNGGKLGFLKPIGKGAFYPNGGKSQPGCGLDATGSCSHARSVLYYAEAV---TEDNFGSI 290
            |:.|.:|.|.||...|:|...||| ||.|....|..:. :|:||||..|:||.|   .|.||.:.
  Fly   265 VDVIHSNPGVLGKRDPVGDVDFYP-GGMSPLAAGCFSV-TCAHARSWEYFAETVFPGNERNFMAT 327

  Fly   291 KCHDYEDAVAKNCGSTYSSVRMG-AITNAYMVEGDFYVPVNSEAPFG 336
            :|:.........|..  ..|.|| |:..  .::|::::.|::.||||
  Fly   328 RCNSISKLRDFRCPG--DEVPMGYAVPQ--NIKGNYFLEVSASAPFG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 86/278 (31%)
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 88/288 (31%)
Pancreat_lipase_like 99..365 CDD:238363 86/279 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446069
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.