DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and Yp3

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster


Alignment Length:347 Identity:88/347 - (25%)
Similarity:152/347 - (43%) Gaps:65/347 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FIPKLDGSFEWMDMQDAEDLLANGAQMEGRISTNAVNFYVYT-KSNPTDGK-EIKAKSGSVEDSH 92
            |:|.......|:       :.:||.::|.::     |.||.| |:.|..|: |:......:..:.
  Fly    82 FVPSPSNVPVWI-------IKSNGQKVECKL-----NNYVETAKAQPGFGEDEVTIVLTGLPKTS 134

  Fly    93 FNKDHGTRFVIHGWTQRYSDDM---NTRITKAWLSKGDYNVIVVD-----WARARS-------VD 142
            ..:....|.:|..:.|:|:...   |.:..:..|...||:....:     |..|::       :|
  Fly   135 PAQQKAMRRLIQAYVQKYNLQQLQKNAQEQQQQLKSSDYDYTSSEEAADQWKSAKAASGDLIIID 199

  Fly   143 YAS--------SVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAHVAGYAGK----TVG 195
            ..|        ::|.|...|..:|:.:..| .:.|:..:.:.:||..:.|||||.||.    ..|
  Fly   200 LGSTLTNFKRYAMLDVLNTGAMIGQTLIDL-TNKGVPQEIIHLIGQGISAHVAGAAGNKYTAQTG 263

  Fly   196 DKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKLGFLKPIGKGAFYPNGGKSQPG 260
            .| :..|.|||||..|....:....||..||.:|::|.|:...:|.....|...|||||    |.
  Fly   264 HK-LRRITGLDPAKVLSKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRCGDVDFYPNG----PS 323

  Fly   261 CGLDATGSC--SHARSVLYYAEAV---TEDNF-----GSIKCHDYEDAVAKNCGSTYSSVRMGAI 315
            .|:..:.:.  :.||:..|:||:|   :|.||     .|:|.:..:|...|.   .|..:::.  
  Fly   324 TGVPGSENVIEAVARATRYFAESVRPGSERNFPAVPANSLKQYKEQDGFGKR---AYMGLQID-- 383

  Fly   316 TNAYMVEGDFYVPVNSEAPFGK 337
               |.:.||:.:.||:::|||:
  Fly   384 ---YDLRGDYILEVNAKSPFGQ 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 78/304 (26%)
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 82/332 (25%)
Abhydrolase <215..396 CDD:304388 57/194 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445880
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.