DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and CG1986

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster


Alignment Length:344 Identity:101/344 - (29%)
Similarity:147/344 - (42%) Gaps:58/344 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IPKLDGSFEWMDMQDA-----EDLLANGAQMEGRISTNAVNFYVYTKSNPTDGKEIKAKSGSVED 90
            :|:::....|..|..|     |.:|.|  .:|.....:.:.|...|.|....|.|:         
  Fly    21 VPRIEAFHRWSPMMKAFRYLQETMLRN--SLERAHLNHGIVFECRTISAKDFGNEV--------- 74

  Fly    91 SHFNKDHG-------------TRFVIHGWTQRYSDDMNTRITKAW-LSKGDYNVIVVDWARARSV 141
             |||...|             ....:|||..:.|.|....:...| |...:|||.||||......
  Fly    75 -HFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTLFDSNYNVCVVDWGNLSQN 138

  Fly   142 DYASSVLAVPGAGGKVGEMIKYL------HDHHGLDYDSLEVIGHSLGAHVAGYAGKTVGDKRVH 200
            ||.|:.:::...|..|..:|..|      |.|.    .::.:.|:|||||.||||| .|.:.:|.
  Fly   139 DYKSASMSIFDVGLTVAGIIMALEELRPNHFHR----SNVTLAGYSLGAHAAGYAG-AVLEGQVE 198

  Fly   201 TIVGLDPALPLFSYD---KPAKRLSTDDAHYVESIQTNGGKLGFLKPIGKGAFYPNGGKS-QPGC 261
            .|:|||||.||||..   .|..||...||.:|:.:.|:||.||.....|...||||||:: |..|
  Fly   199 QIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNGGRAPQTNC 263

  Fly   262 GLDAT---------GSCSHARSVLYYAEAV-TEDNFGSIKCHDYEDAVAKNCGSTYSSVRMGAIT 316
            .:.|.         .||||:.:.:::.::: .|..|...:|..|.:..|..|... ...|.| |.
  Fly   264 KMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFVGYECGSYREFAAGYCDGN-RKARFG-IH 326

  Fly   317 NAYMVEGDFYVPVNSEAPF 335
            :....:|.||.....:.|:
  Fly   327 SQRRAQGSFYFRTAPQQPY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 92/299 (31%)
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 89/290 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.