DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and CG5966

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster


Alignment Length:346 Identity:86/346 - (24%)
Similarity:140/346 - (40%) Gaps:86/346 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EWMDMQDAEDLLANGAQMEGRISTNAVNFYVYTKSNPTDGKEIKAKSGSVEDSHFNKDHGTRFVI 103
            :::|:.|.|.:...|...:|:|.                                       .::
  Fly    92 KYLDLNDPESVQGMGMNPKGKIF---------------------------------------LLV 117

  Fly   104 HGWTQRYSDDMNTRITKAWLS---KGDYNVIVVDWARARSVDYASSVLAVPGAGGKVGEMIKYLH 165
            ||:.:.........:.||.|:   :|..:|:::||....|..|..:|..:...|.....::..|:
  Fly   118 HGYLESGEIPWMWDMAKALLAHEPEGRASVVLIDWGGGASPPYVQAVANIRLVGAITAHVVHMLY 182

  Fly   166 DHHGL-DYDSLEVIGHSLGAHVAGYAG----KTVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDD 225
            :...| :.|::.:||||||||::||||    ...|.|... |.|||||.|||:...|..||...|
  Fly   183 EELRLPNLDNVHIIGHSLGAHLSGYAGYHLQHDFGLKPAR-ITGLDPAAPLFTDTDPIVRLDKTD 246

  Fly   226 AHYVESIQTNG-----GKLGFLKPIGKGAFYPNGGKSQPGCG---------------LDATGSCS 270
            ||:|:.:.|:.     |.||....:|...|:||||...|||.               :.....|:
  Fly   247 AHFVDIVHTDANPLMKGGLGINMRLGHVDFFPNGGFDNPGCNKKFQDVVKKKTLFLTMQEFLGCN 311

  Fly   271 HARSVLYYAEAV-TEDNFGSIKCHDYEDAVAKNCGST----YSSVRMG---------AITNAYMV 321
            |.||..|:.|:: ::..|..|.|..:|......|.|.    ::.:|||         .:....:.
  Fly   312 HIRSQQYFTESIGSQCPFLGITCDSFESFKDTKCTSCEEPGHTCLRMGYHSQEDYQEQVDLGQLQ 376

  Fly   322 EGD----FYVPVNSEAPFGKI 338
            :||    ||:......||.::
  Fly   377 QGDSPGVFYLWTGDSKPFCRL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 78/311 (25%)
CG5966NP_572286.1 Lipase 46..394 CDD:278576 84/341 (25%)
Pancreat_lipase_like 76..390 CDD:238363 84/337 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.