DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and Lipi

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi / 288322 RGDID:1310162 Length:476 Species:Rattus norvegicus


Alignment Length:303 Identity:102/303 - (33%)
Similarity:153/303 - (50%) Gaps:37/303 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 TNAVNFYVYTKSNPTDGKEIKAKSGSVEDSHFNKDHGTRFVIHGWTQRYSDDM-NTRITKAWLSK 125
            |..:|..:|:::|....:.:...:.|| ::.||....|.::|||:....|..| ..:.|||:|.:
  Rat    56 TVKINLLMYSRNNAKCAEPLFESNNSV-NARFNPSKKTIWIIHGYRPLGSTPMWIHKFTKAFLKQ 119

  Fly   126 GDYNVIVVDWAR-ARSVDYASSVLAVPGAGGKVGEMIK-YLHD--HHGLDYDSLEVIGHSLGAHV 186
            .|.|:|||||.: |.:..|..:|...    .||.|::: |:.:  .||...|:...||.|||||:
  Rat   120 EDVNLIVVDWNQGATTFIYGRAVKNT----RKVAEILREYIENLLIHGASLDNFHFIGMSLGAHI 180

  Fly   187 AGYAGKTVGDKRVHTIVGLDPALPLFSYDKPAK-RLSTDDAHYVESIQTNGGKLGFLKPIGKGAF 250
            .|:.|| :...::..|.|||||.|.|| .||:. ||...||.:|:.|.::....|.|:|.|...|
  Rat   181 CGFVGK-LFQGQLGRITGLDPAGPKFS-GKPSNCRLDYTDAKFVDVIHSDSQGFGILEPSGHIDF 243

  Fly   251 YPNGGKSQPGC------GLDATGSCSHARSVLYYAEAV-TEDNFGSIKC---HDYEDAVAKNCGS 305
            |||||::||||      |:|.. .|.|.|:|..:.||. |..||.|..|   .||:..:...||:
  Rat   244 YPNGGRNQPGCPTSLLSGMDYI-KCDHQRAVHLFLEAFETNCNFVSFPCRSYRDYKSGLCVGCGN 307

  Fly   306 TY--SSVRMGAITNAYMVE-----------GDFYVPVNSEAPF 335
            .|  |..|:|...|.:..|           ...::..:|:.||
  Rat   308 LYKDSCPRLGIQANLWKEELKKKTEEWPLRTTAFLDTSSQNPF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 98/294 (33%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 98/296 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339004
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.