DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and Liph

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001077363.1 Gene:Liph / 239759 MGIID:2388029 Length:451 Species:Mus musculus


Alignment Length:267 Identity:83/267 - (31%)
Similarity:129/267 - (48%) Gaps:45/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AVNFYVYTKSNPTDGKEIKAKS-GSVEDSHFNKDHGTRFVIHG---------WTQRYSDDMNTRI 118
            :|...:||:.:.|..:.|.:.: ||:     |....|.|:|||         |.:        .:
Mouse    40 SVRLMLYTQRDQTCAQIINSTALGSL-----NVTKKTTFIIHGFRPTGSPPVWIE--------EL 91

  Fly   119 TKAWLSKGDYNVIVVDWARARSVDYASSVLAVPGAGGK---VGEMIKYLHDH---HGLDYDSLEV 177
            .::.:|..:.||:||||.|.     |::|: .|.|..|   |..::|...|.   .|...|::.:
Mouse    92 VQSLISVQEMNVVVVDWNRG-----ATTVI-YPHASSKTRQVASILKEFIDQMLVKGASLDNIYM 150

  Fly   178 IGHSLGAHVAGYAGKTVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKLGFL 242
            ||.|||||:||:.|::. :.::..:.|||||.|||:...|.:||...||.:|:.|.::...||:.
Mouse   151 IGVSLGAHIAGFVGESY-EGKLGRVTGLDPAGPLFNGRPPEERLDPSDALFVDVIHSDTDALGYK 214

  Fly   243 KPIGKGAFYPNGGKSQPGCGLDATG-----SCSHARSV-LYYAEAVTEDNFGSIKC---HDYEDA 298
            :.:|...||||||..||||.....|     .|.|..|| ||.|......:..:..|   .||.:.
Mouse   215 EALGHIDFYPNGGLDQPGCPKTIFGGIKYFKCDHQMSVYLYLASLQNNCSITAYPCDSYRDYRNG 279

  Fly   299 VAKNCGS 305
            ...:||:
Mouse   280 KCVSCGA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 83/266 (31%)
LiphNP_001077363.1 Pancreat_lipase_like 41..310 CDD:238363 83/266 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835342
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.