DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_035258.2 Gene:Pnliprp2 / 18947 MGIID:1336202 Length:482 Species:Mus musculus


Alignment Length:336 Identity:95/336 - (28%)
Similarity:142/336 - (42%) Gaps:55/336 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFFVLAALLAAVSALPIEERVNGENGWF---------IPKLDGSFEWMDMQDAEDLLANGAQM 56
            |.:.::::.|||.|..   :|...|..|.|         |.:....|.|    ..||:       
Mouse    15 MLLCWLVSLLLATVGG---KEVCYGHLGCFSNDKPWAGMIQRPSKIFPW----SPEDI------- 65

  Fly    57 EGRISTNAVNFYVYTKSNPTDGKEIKAKS-GSVEDSHFNKDHGTRFVIHGWTQRYSDDMNTRITK 120
                   ...|.:||..||.:.:.|.|.. .::..|:|..|..|||:|||:..:..:.....:.|
Mouse    66 -------DTRFLLYTNENPNNYQIISATDPATINASNFQLDRKTRFIIHGFIDKGEEGWLLDMCK 123

  Fly   121 AWLSKGDYNVIVVDWARARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAH 185
            ........|.|.|||.|....:|..:.......|.::..:::.|....|...:::.:||||||:|
Mouse   124 KMFQVEKVNCICVDWKRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGSH 188

  Fly   186 VAGYAGKTVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKL------GFLKP 244
            |||.||:.: :..|..|.|||||.|.|.......||...||.:|:.|.|:...:      |..:.
Mouse   189 VAGEAGRRL-EGHVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQK 252

  Fly   245 IGKGAFYPNGGKSQPGCG-------LDATG---------SCSHARSVLYYAEAV-TEDNFGSIKC 292
            :|...|:|||||..|||.       :|..|         :|:|.||..|||.:: ..|.|....|
Mouse   253 VGHLDFFPNGGKEMPGCQKNILSTIVDINGIWEGTRNFAACNHLRSYKYYASSILNPDGFLGYPC 317

  Fly   293 HDYEDAVAKNC 303
            ..||.....:|
Mouse   318 SSYEKFQHNDC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 81/263 (31%)
Pnliprp2NP_035258.2 Lipase 31..367 CDD:278576 90/317 (28%)
Pancreat_lipase_like 65..363 CDD:238363 81/279 (29%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 106..118 3/11 (27%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 270..292 2/21 (10%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835372
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.