DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and Lipg

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_034850.3 Gene:Lipg / 16891 MGIID:1341803 Length:500 Species:Mus musculus


Alignment Length:315 Identity:99/315 - (31%)
Similarity:144/315 - (45%) Gaps:61/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AVNFYVYTKSNP-TDGKEIK-AKSGSVEDSHFNKDHGTRFVIHGWTQRYSDDMNTRITKAWLSK- 125
            :|.|.:.|..:| .:|..:. ..|..:|:..||....|.|:|||||.       :.:.::||.| 
Mouse    48 SVAFNIRTSKDPEQEGCNLSLGDSKLLENCGFNMTAKTFFIIHGWTM-------SGMFESWLHKL 105

  Fly   126 --------GDYNVIVVDWARARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSL 182
                    .|.||:||||.......|..:|......|.:|..|:.:|.:.......::.:||:||
Mouse   106 VSALQMREKDANVVVVDWLPLAHQLYTDAVNNTRVVGQRVAGMLDWLQEKEEFSLGNVHLIGYSL 170

  Fly   183 GAHVAGYAGK----TVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTN----GGKL 239
            |||||||||.    |||     .|.|||||.|:|......:|||.|||.:|:.:.|.    |..:
Mouse   171 GAHVAGYAGNFVKGTVG-----RITGLDPAGPMFEGVDINRRLSPDDADFVDVLHTYTLSFGLSI 230

  Fly   240 GFLKPIGKGAFYPNGGKSQPGCGL-DATGS-----------CSHARSV-LYYAEAVTED--NFGS 289
            |...|:|....|||||..|||||. |..||           |.|.|:| |:....|.:|  :| :
Mouse   231 GIRMPVGHIDIYPNGGDFQPGCGFNDVIGSFAYGTISEMVKCEHERAVHLFVDSLVNQDKPSF-A 294

  Fly   290 IKCHD---YEDAVAKNCGST------YSSVRMGAITNAYMVEGDFYVPVNSEAPF 335
            .:|.|   ::..:..:|...      |::.:|....|:.|     |:...:..||
Mouse   295 FQCTDSSRFKRGICLSCRKNRCNNIGYNAKKMRKKRNSKM-----YLKTRAGMPF 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 97/308 (31%)
LipgNP_034850.3 Pancreat_lipase_like 49..340 CDD:238363 97/308 (31%)
lipo_lipase 51..485 CDD:132274 98/312 (31%)
Heparin-binding. /evidence=ECO:0000250 325..337 4/16 (25%)
PLAT_LPL 347..483 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.