DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and Lipc

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_006510879.1 Gene:Lipc / 15450 MGIID:96216 Length:526 Species:Mus musculus


Alignment Length:326 Identity:88/326 - (26%)
Similarity:143/326 - (43%) Gaps:67/326 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 FYVYTKSNPTDGKEIKAK-SGSVEDSHFNKDHGTRFVIHGWT---------QRYSDDMNTRITKA 121
            |.::...|...|..::.: ..::::..||.......:||||:         ...||.....:.:.
Mouse    51 FLLFQDENDRLGCRLRPQHPETLQECGFNSSQPLIMIIHGWSGSESATVGKDSDSDYQVDGLLEN 115

  Fly   122 WLSK----------GDYNVIVVDWARARSVDYASSVLAVPG---AGGKVGEMIKYLHDHHGLDYD 173
            |:.|          ...||.:|||.   |:.|....:||..   .|..|..::.:|.:.......
Mouse   116 WIWKIVSALKSRQSQPVNVGLVDWI---SLAYQHYTIAVQNTRIVGQDVAALLLWLEESAKFSRS 177

  Fly   174 SLEVIGHSLGAHVAGYAGKTV-GDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQT--- 234
            .:.:||:||||||:|:||.:: |..::..|.|||||.|:|....|.:|||.|||::|::|.|   
Mouse   178 KVHLIGYSLGAHVSGFAGSSMDGKNKIGRITGLDPAGPMFEGTSPNERLSPDDANFVDAIHTFTR 242

  Fly   235 --NGGKLGFLKPIGKGAFYPNGGKSQPGC------------GLDA---TGSCSHARSVLYYAEAV 282
              .|..:|..:||....||||||..||||            ||:|   |..|:|.|||..:.:::
Mouse   243 EHMGLSVGIKQPIAHYDFYPNGGSFQPGCHFLELYKHIAEHGLNAITQTIKCAHERSVHLFIDSL 307

  Fly   283 TEDNFGSI--KCHD---YEDAVAKNC--------GSTYSSVRMGAITNAYMVEGDFYVPVNSEAP 334
            ...:..||  :|.|   :...:..:|        |......|.|.....:::       ..:::|
Mouse   308 QHSDLQSIGFQCSDMGSFSQGLCLSCKKGRCNTLGYDIRKDRSGKSKRLFLI-------TRAQSP 365

  Fly   335 F 335
            |
Mouse   366 F 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 86/320 (27%)
LipcXP_006510879.1 Lipase 18..366 CDD:333880 86/324 (27%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835352
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.