DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:317 Identity:94/317 - (29%)
Similarity:136/317 - (42%) Gaps:51/317 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RISTNAVNFYVYTKSNPTDGKEIKA-KSGSVEDSHFNKDHGTRFVIHGWTQ--RYSDDMNTRITK 120
            :|:|   .|.:||..||...:||.| .|.:::.|:|..|..||..|.||..  ::..||    ..
Human    51 KINT---RFLLYTIHNPNAYQEISAVNSSTIQASYFGTDKITRINIAGWKTDGKWQRDM----CN 108

  Fly   121 AWLSKGDYNVIVVDWARARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAH 185
            ..|...|.|.|.:||... |.:|..:|..:...|.:|...|..|..........:.:||||||||
Human   109 VLLQLEDINCINLDWING-SREYIHAVNNLRVVGAEVAYFIDVLMKKFEYSPSKVHLIGHSLGAH 172

  Fly   186 VAGYAGKTVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKL------GFLKP 244
            :||.||..:  ..:..|.|||||.|.|.......||...||::|:.|.||..::      |.:..
Human   173 LAGEAGSRI--PGLGRITGLDPAGPFFHNTPKEVRLDPSDANFVDVIHTNAARILFELGVGTIDA 235

  Fly   245 IGKGAFYPNGGKSQPGC-----------------GLDATGSCSHARSVLYYAEAV-TEDNFGSIK 291
            .|...|||||||..|||                 .:.:...|:||||..:|||:: ..|.|.:..
Human   236 CGHLDFYPNGGKHMPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSYQFYAESILNPDAFIAYP 300

  Fly   292 CHDYEDAVAKNCGSTYSSVRMGAITNAYMVE-----------GDFYVPVNSEAPFGK 337
            |..|....|.||   :...:.|..|..:..:           ..:::...|.:||.:
Human   301 CRSYTSFKAGNC---FFCSKEGCPTMGHFADRFHFKNMKTNGSHYFLNTGSLSPFAR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 89/303 (29%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 92/313 (29%)
Pancreat_lipase_like 52..348 CDD:238363 91/308 (30%)
PLAT_PL 355..467 CDD:238857 94/317 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145252
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.