DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and pnliprp3

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_031761690.1 Gene:pnliprp3 / 100487975 XenbaseID:XB-GENE-6250474 Length:420 Species:Xenopus tropicalis


Alignment Length:270 Identity:89/270 - (32%)
Similarity:127/270 - (47%) Gaps:29/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ISTNAVN--FYVYTKSNPTDGKEIKAKSGSVEDSHFNKDHGTRFVIHGWTQRYSDDMNTRITKAW 122
            :|..|:|  :::.|:.||...:||.:.| ||..|:|..:..|||:|||:...........:.:..
 Frog     1 MSPEAINTRYFLVTRENPDYFQEIISHS-SVSTSNFKPNRKTRFIIHGFVNTAERGWQMEMCQVM 64

  Fly   123 LSKGDYNVIVVDWARARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAHVA 187
            |...|.|...:||.......|..:...:...|.::...|.||..::......:.:||||||||||
 Frog    65 LEVEDVNCFCIDWRGGSFTLYTQAANNIRVVGAELASFIGYLSKNYDYSPSMIHIIGHSLGAHVA 129

  Fly   188 GYAGKTVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGK------LGFLKPIG 246
            |.|||.|  ..:..|.|||||.|||....|..||...||.:|::|.|:...      ||..:.:|
 Frog   130 GEAGKRV--PGIARISGLDPAGPLFQNTPPEVRLDPTDADFVDAIHTDTSPLIPKIGLGMAQSVG 192

  Fly   247 KGAFYPNGGKSQPGC----------------GLDATGSCSHARSVLYYAEAV-TEDNFGSIKCHD 294
            ...|:||||::.|||                |.|...:|:|.||..||.|:: |.|.|.:.....
 Frog   193 HLDFFPNGGQTMPGCGSNIITRLLDIEELWGGADNYLACNHLRSYKYYTESIRTPDAFVAFPSDT 257

  Fly   295 YEDAVAKNCG 304
            || |..|..|
 Frog   258 YE-AFMKGTG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 87/265 (33%)
pnliprp3XP_031761690.1 Lipase 2..304 CDD:395099 89/269 (33%)
PLAT 307..417 CDD:412108
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.