DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6283 and LOC100331214

DIOPT Version :9

Sequence 1:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:306 Identity:92/306 - (30%)
Similarity:136/306 - (44%) Gaps:63/306 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LDGSFEWM--DMQDAEDLLANGAQMEGRISTNAVNFYVYTKSNPTDG--KEIKAKSGSVEDSHFN 94
            |:|.|:..  |::|..|           :....|.|.:...|.|.|.  ..::.|:.::...:||
Zfish    31 LNGVFDHFLEDLRDLSD-----------VKKLNVKFSLRNPSQPDDDVCYIVRGKAETLSSCNFN 84

  Fly    95 KDHGTRFVIHGWTQRYSDDMNTRITKAWLSK---------GDYNVIVVDWARARSVDYASSVLAV 150
            ....|..||||||.       :.:.::|:.|         .|.|||||||.......|..:....
Zfish    85 HTSKTILVIHGWTV-------SGLFESWVEKLVAALYNREKDANVIVVDWLDTAQDHYVVAAQNT 142

  Fly   151 PGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAHVAGYAGKTVGDKRVHTIVGLDPALPLFSYD 215
            ...|.::|..|.::.:...:..::|.:||:||||||||:||....:| :..|.|||||.|.|...
Zfish   143 KMVGREIGLFIDWIEETSNVPLENLHLIGYSLGAHVAGFAGSHTTNK-IGRITGLDPAGPDFEGV 206

  Fly   216 KPAKRLSTDDAHYVESIQT-----NGGKLGFLKPIGKGAFYPNGGKSQPGC------------GL 263
            ....|||.||||:|:.:.|     .|..:|..:|:|....|||||..||||            |:
Zfish   207 HAHGRLSPDDAHFVDVLHTFTRGSLGLSIGIEQPVGHVDIYPNGGSFQPGCNLRGALEKMASYGI 271

  Fly   264 DATGS---CSHARSV-LYYAEAVTEDNFGSIKCHDYEDAVAKNCGS 305
            .|..:   |.|.||: |:....:.|:..|.          |.:|||
Zfish   272 FAINNAIRCEHERSIHLFIDSLLNEEAAGR----------AYSCGS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 86/273 (32%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 87/290 (30%)
Pancreat_lipase_like 51..347 CDD:238363 86/275 (31%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578513
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.