DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:273 Identity:90/273 - (32%)
Similarity:131/273 - (47%) Gaps:37/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IETRSNDVSFYLYTKHNPTVGKEIR-ADASSIEDSHFDKNQGTRFVIHGWNGRYTDGMNVKITRA 119
            |.||     |.|||..|||..:.:: :|..:|..|:|...:.|||:|||:..:..:...|.:.:.
  Rat    52 INTR-----FLLYTNENPTAFQTLQLSDPLTIGASNFQVARKTRFIIHGFIDKGEENWVVDMCKN 111

  Fly   120 WLSKGDYNVIVVNWDRAQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHV 184
            .....:.|.|.|:|.:.....|..:...|...||:|.:||:.|.:::..|...:.:|||||||||
  Rat   112 MFQVEEVNCICVDWKKGSQTTYTQAANNVRVVGAQVAQMIDILVKNYSYSPSKVHLIGHSLGAHV 176

  Fly   185 AGYAGKQVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGEKGFLKP-IGKGT- 247
            ||.||.:..|  :..|.||||....|.....:.||...||.:|:.|.|:...   |.| :|.|| 
  Rat   177 AGEAGSRTPG--LGRITGLDPVEANFEGTPEEVRLDPSDADFVDVIHTDAAP---LIPFLGFGTN 236

  Fly   248 -------FYPNGGRNQPGCGS-------DIGG---------TCAHGRSVTYYVEAV-TEDNFGTI 288
                   |:||||::.|||..       ||.|         .|.|.||..||:|:: ..|.|...
  Rat   237 QMSGHLDFFPNGGQSMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESILNPDGFAAY 301

  Fly   289 KCHDYQAALANEC 301
            .|..|:...:|:|
  Rat   302 PCASYKDFESNKC 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 87/267 (33%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 90/273 (33%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338966
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.