DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and PNLIPRP2

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_005387.3 Gene:PNLIPRP2 / 5408 HGNCID:9157 Length:469 Species:Homo sapiens


Alignment Length:264 Identity:87/264 - (32%)
Similarity:124/264 - (46%) Gaps:25/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DVSFYLYTKHNPTVGKEIR-ADASSIEDSHFDKNQGTRFVIHGWNGRYTDGMNVKITRAWLSKGD 125
            |..|.|||..||...:.|. .:..:||.|:|..::.|||:|||:..:..|.....:.:.......
Human    53 DTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEK 117

  Fly   126 YNVIVVNWDRAQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGYAGK 190
            .|.|.|:|.......|..:|:.:...||:...:|:.|......|:|.:.|||||||||.|..||:
Human   118 VNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGR 182

  Fly   191 QVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGE------KGFLKPIGKGTFY 249
            ::|| ||..|.|||||.|.|..:..:.||...||.:|:.|.|:...      .|..:.:|...|:
Human   183 RLGG-RVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFF 246

  Fly   250 PNGGRNQPGCGSD--------------IGG--TCAHGRSVTYYVEAV-TEDNFGTIKCHDYQAAL 297
            ||||:..|||..:              |||  :|.|.||..||..:| ..|.|....|..|....
Human   247 PNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQ 311

  Fly   298 ANEC 301
            .::|
Human   312 ESKC 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 87/264 (33%)
PNLIPRP2NP_005387.3 Lipase 18..354 CDD:395099 87/264 (33%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 93..105 4/11 (36%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 257..279 3/21 (14%)
PLAT_PL 357..469 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.