DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and PNLIPRP1

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001290064.1 Gene:PNLIPRP1 / 5407 HGNCID:9156 Length:467 Species:Homo sapiens


Alignment Length:264 Identity:83/264 - (31%)
Similarity:125/264 - (47%) Gaps:32/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FYLYTKHNPTVGK-EIRADASSIEDSHFDKNQGTRFVIHGWNGRYTDGMNVKITRAWLSKGDYNV 128
            |.|||..||...: .:.:|.|:||.|:|..::.|||:|||:..:..:.....:.:......:.|.
Human    56 FLLYTNENPNNFQILLLSDPSTIEASNFQMDRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNC 120

  Fly   129 IVVNWDRAQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGYAGKQVG 193
            |.|:|.:.....|..:...|...||:|.:|::.|...:......:.:|||||||||||.||.:..
Human   121 ICVDWKKGSQATYTQAANNVRVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEAGSKTP 185

  Fly   194 GKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGEKGFLKP-IGKGT--------FY 249
            |  :..|.||||....|.....:.||...||.:|:.|.|:...   |.| :|.||        |:
Human   186 G--LSRITGLDPVEASFESTPEEVRLDPSDADFVDVIHTDAAP---LIPFLGFGTNQQMGHLDFF 245

  Fly   250 PNGGRNQPGCGS-------DIGG---------TCAHGRSVTYYVEAV-TEDNFGTIKCHDYQAAL 297
            ||||.:.|||..       |:.|         .|.|.||..||:|:: ..|.|....|..|::..
Human   246 PNGGESMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESILNPDGFAAYPCTSYKSFE 310

  Fly   298 ANEC 301
            :::|
Human   311 SDKC 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 83/264 (31%)
PNLIPRP1NP_001290064.1 Lipase 18..353 CDD:278576 83/264 (31%)
Pancreat_lipase_like 52..349 CDD:238363 83/264 (31%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145289
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7429
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.