DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and PNLIP

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:310 Identity:100/310 - (32%)
Similarity:138/310 - (44%) Gaps:36/310 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IETRSNDVSFYLYTKHNPTVGKEIRADASSIEDSHFDKNQGTRFVIHGWNGRYTDGMNVKITRAW 120
            :.||     |.|||..||...:|:.||:|||..|:|..|:.|||:|||:..:..:.....:.:..
Human    51 VNTR-----FLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNL 110

  Fly   121 LSKGDYNVIVVNWDRAQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVA 185
            ......|.|.|:|.......|..:.:.:...||:|...:|:|......|..::.|||||||||.|
Human   111 FKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAA 175

  Fly   186 GYAGKQVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGE------KGFLKPIG 244
            |.||::..| .:..|.|||||.|.|.......||...||.:|:.|.|:|..      .|..:.:|
Human   176 GEAGRRTNG-TIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVG 239

  Fly   245 KGTFYPNGGRNQPGCGS-------DIGG---------TCAHGRSVTYYVEA-VTEDNFGTIKCHD 292
            ...|:||||...|||..       ||.|         .|.|.||..||.:: |..|.|....|..
Human   240 HLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCAS 304

  Fly   293 YQAALANECGSTYSG--VRMGAVTNAYM-----VDGDFYVPVNGQAPFGK 335
            |....||:|....||  .:||...:.|.     |...||:.....:.|.:
Human   305 YNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFAR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 97/295 (33%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 99/306 (32%)
PLAT_PL 355..465 CDD:238857 100/310 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145319
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.