DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and CG4582

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster


Alignment Length:309 Identity:100/309 - (32%)
Similarity:149/309 - (48%) Gaps:41/309 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MDKQDAEELLNRNSLIETRSNDVSFYLYTKHNPTVGKEIRADASSIEDSHFDKNQGTRFVIHGWN 105
            |:|.|.|:  |:    :..|..|:.|               ||:|:..|.|.....||.:||||.
  Fly   130 MNKGDQEQ--NQ----QFTSEPVNLY---------------DAASLRRSRFSPFNPTRILIHGWL 173

  Fly   106 GRYTDGMNVKITRAW--LSKGDYNVIVVNWDRAQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHL 168
            |.....|..::..|:  |..|:||:..|:|.|....|||::...|...|..:.:.:::||:...:
  Fly   174 GNENANMYNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGM 238

  Fly   169 SMESLEVIGHSLGAHVAGYAGKQVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTN 233
            ..|.|:::|.|:||||||.|||.:...|:..|..||||:|.|.|.||.:||:.|||.|||.:.|:
  Fly   239 RFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTS 303

  Fly   234 GGEKGFLKPIGKGTFYPNGGRNQPGCGSDIGGTCAHGRSVTYYVEAVTED------NFGTIKCHD 292
            .|..||.:|:|...||.|.|..||||   ....|:|.|:...:.|::..|      :.|......
  Fly   304 VGSYGFDRPVGHVDFYANWGSQQPGC---FWHECSHWRAFMLFAESLARDQATGFLSQGCPAAEW 365

  Fly   293 YQAALANECGSTYSGV--RMGA----VTNAYMV--DGDFYVPVNGQAPF 333
            .|....:.|... :||  .||.    |:..::.  .|.:|...|.|.|:
  Fly   366 QQLTRFHRCPKD-TGVMQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPY 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 91/281 (32%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 93/293 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438399
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405444at33208
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.