DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and CG10116

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:283 Identity:72/283 - (25%)
Similarity:130/283 - (45%) Gaps:31/283 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DVSFYLYTKHNPTVGKEIRADASSIEDSHFDKNQGTRFVIHGWNGRYTDGMNVKITRAWLSKGDY 126
            :..|:|.|:......:.|.|:..::..|.|.....|...|..|.|..:......:..|.|.:.|.
  Fly    21 ETGFFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDS 85

  Fly   127 NVIVVNW----DRAQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGY 187
            |:|.|:.    |..:.:|.::|             ::..||....:.::.:.|:|.:.|||:||.
  Fly    86 NIISVDLSEANDETEIIDSVAS-------------LVIVLHNQFDMPLDRILVVGFAEGAHLAGG 137

  Fly   188 AGKQVG---GKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGEKGFLKPIGKGTFY 249
            ...:|.   |:::..|..|||:    :..:.|.:||..||.:||.:.||.|.:|..:.:|...:|
  Fly   138 VAAKVQQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYY 198

  Fly   250 PNGGRNQPGCGSDIGGTCAHGRSVTYYVEAVT-EDNFGTIKCHDYQAALANECGSTYSGVRMGAV 313
            ||||:.||||.:|   :|:|.|:.....|..: |::|.:.:|...:...|:.|  .:|..:||..
  Fly   199 PNGGQTQPGCTTD---SCSHERAFELLAEMWSPENDFVSARCGSVETLSASSC--RWSTHKMGQK 258

  Fly   314 TNAYM-VDGDFYVPVNGQAPFGK 335
            ..... ..|.:::.....:||.:
  Fly   259 QEEEQPASGIYFLETRQSSPFSR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 70/274 (26%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 70/271 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445962
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.