DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17191 and CG6472

DIOPT Version :9

Sequence 1:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:295 Identity:96/295 - (32%)
Similarity:153/295 - (51%) Gaps:29/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DVSFYLYTKHNPTVGKEIR-ADASSIEDSHFDKNQGTRFVIHGWN----GRYTDGMNVKITRAWL 121
            |:.|.|||..|....:.:. :|.:.:..|:|:.|......:||::    |.......:|  .|:|
  Fly    43 DIKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQELK--DAFL 105

  Fly   122 SKGDYNVIVVNWDRAQSVD-YISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVA 185
            .:|:||||:::|....:|. |.::|..:|.:|..:...:.:|.:..: ..:.:.:||.||||.||
  Fly   106 RRGNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDKGY-PAKYIHLIGFSLGAEVA 169

  Fly   186 GYAGKQV--GGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGEKGFLKPIGKGTF 248
            |:||||:  .|.::..|..||||:|||..:..::|||..||.:|:.|.|:||..|...|:|...|
  Fly   170 GFAGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADF 234

  Fly   249 YPNGGRN-QPGC----------GSDIGGTCAHGRSVTYYVEAVTED-NFGTIKCHDYQA-ALANE 300
            ||||||. ||||          |..:|  |:|.|:..|:||::.:. .|...:|..... .:..|
  Fly   235 YPNGGRPLQPGCAKQNIANNWLGIIVG--CSHQRAWEYFVESIAQPRGFPAQRCEPSDMFGICRE 297

  Fly   301 CGSTYSGVRMGAVTNAYMVDGDFYVPVNGQAPFGK 335
            .|...:.:.|||...   :.|.||:..|...|||:
  Fly   298 PGGGPAFMGMGADPR---IRGKFYLDTNDAKPFGR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 92/286 (32%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 92/287 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.